KEGG   Klebsiella pneumoniae: KPR_3119Help
Entry
KPR_3119          CDS       T02793                                 

Gene name
tdk
Definition
hypothetical protein
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
kpr  Klebsiella pneumoniae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KPR_3119 (tdk)
Enzymes [BR:kpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     KPR_3119 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(3192299..3192973)
Genome map
AA seq 224 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAR
LYNPQTSLFDDIAAEHQLKPIHCVLVDESQFLTREQVHELSEVVDTLDIPVLCYGLRTDF
RGELFTGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQEGRPYNEGEQVVIGGNERYVS
VCRKHYKEALSVGSLTKVQKSLLIPSEARTGACGRLFNVCYRLA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttctactactctgcaatgaatgcaggtaagtcgaccgctctgttg
caatcttcgtacaattaccaggaacgggggatgcgtaccgtcgtttataccgctgagatt
gatgaccgctttggcgccggaaaagtcagttcacgtatcgggctctcctcgccggcccga
ttgtataatccacagacctcgttatttgacgatattgcggcggagcaccagctaaagccg
attcactgcgtgctggtggatgaaagccagtttctgacgcgtgaacaggttcatgagctg
tccgaagttgtcgatacgctggatattccggtgctttgctatgggttgcggacggacttt
cgcggtgagctctttaccggcagccagtatttactggcctggtcagataagctggttgag
ctgaaaacgatctgcttctgcggccgcaaggccagcatggtattgcgcctcgatcaggag
gggcgtccttataatgagggtgagcaggtcgtcatcggcggtaatgagcggtacgtatcg
gtctgccgtaagcattataaagaggcgctgagcgtcggttcgttaaccaaggtacaaaag
tccctgctgataccctcagaagctcgtacaggcgcctgtgggcgcctttttaatgtctgc
tataggttggcgtag

DBGET integrated database retrieval system