KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_3369Help
Entry
KPR_3369          CDS       T02793                                 

Gene name
amyA
Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
3458144..3459613
Genome map
AA seq 489 aa AA seqDB search
MQCFHWYYPTGGELWPEVEALAPSLNEIGINMVWLPPAYKGASGGYSVGYDTYDLFDLGE
FDQKGSVATKYGDKAQLLAAINALKEHNIAVLLDVVVNHKMGADEKEALRVQRVDEQDRT
QIDEEIIECEAWTRYTFPVRAGQYSQFVWDYKCFSGIDHIENPTEDGVFKIVNDYTGEGW
NEQVDDELGNFDYLMGANIDFRNHAVTEEIKYWARWVMEQTGCDGFRLDAVKHIPAWFYK
AWIEHVQEVAPQPLFIVEEYWSHEVEKLQQYIDLVEGKTMLFDAPLQMKFHEASRQGRDY
DMSQIFSGTLVEADPFHAVTLVTNHDTQPLQALEAPVEPWFKPLAYALILLRENGVPSVF
YADLFGASYEDTGGDGQTYAIEMPVIEQLHELIDARQRFAHGVQTLWFDHPNCIAFSRSG
TDDDPGCVVIMSNGDEGEKALTLGENYGNKRWRDFLGNREEIVETDGEGCATFTCNGGSV
SVWVLEEVL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatgttttcactggtactaccccaccggcggcgagctgtggcctgaggtcgaagcg
ctggcgcccagcctgaatgaaatcggcatcaatatggtctggttgccacccgcctacaaa
ggcgcctcgggcggttactccgtcggctatgatacctacgatctctttgacctcggcgag
tttgatcaaaaagggtctgtcgccaccaaatatggcgacaaagcgcagttgctggcggcg
atcaacgccctgaaggagcacaatatcgccgtgctgctggatgtagtggtcaaccataaa
atgggcgctgatgaaaaagaggctctgcgcgttcagcgcgtcgatgagcaggatcgtacg
caaattgacgaggaaatcattgagtgcgaggcatggacgcgctacaccttcccggtgcgc
gccggacagtattcgcagtttgtctgggactacaaatgttttagcggcattgaccacatc
gagaacccgacggaagacggtgtgtttaaaatcgtcaacgattacaccggcgaaggctgg
aatgaacaggtcgatgatgagctcggcaactttgactatctgatgggcgccaatatcgat
ttccgcaatcatgcagtgaccgaggagatcaaatactgggcgcgctgggtaatggagcag
accggctgcgacggttttcgtcttgacgcggtcaagcatatccccgcctggttttataaa
gcgtggatcgagcatgttcaggaggtggccccgcagccgctgtttattgtagaggaatac
tggtcccatgaagtggagaagctccagcagtatatcgacctggtcgagggcaaaacgatg
ctgtttgatgccccactgcagatgaaatttcatgaagcgtcgcgccagggccgcgattat
gacatgagccagattttcagcgggacgctggtcgaagccgaccctttccatgccgtcact
ctggtcaccaatcatgatacgcagccgctgcaggccctcgaggcgccggttgaaccctgg
ttcaagcccctcgcctatgcgctgatcctgctgcgggagaatggcgtgccctcggtcttt
tatgccgatctcttcggcgcttcctatgaggataccggcggcgacggacagacatatgcc
attgagatgcccgtcatcgaacaactccacgagctgatcgacgcccgtcagcgttttgcc
catggcgtgcaaaccctttggttcgatcatcctaactgcatcgcctttagtcgtagcggt
actgacgacgatccaggctgcgtggtgatcatgtccaatggcgatgagggcgaaaaggcg
ctgacgctgggcgaaaactatggcaacaaacgctggcgggattttctcggtaaccgggaa
gagattgtcgaaaccgatggcgaaggctgcgcgacctttacttgtaacggggggagcgtt
agcgtgtgggtgttagaggaggtgctgtag

DBGET integrated database retrieval system