KEGG   Klebsiella pneumoniae: KPR_3369Help
Entry
KPR_3369          CDS       T02793                                 

Gene name
amyA
Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
kpr  Klebsiella pneumoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPR_3369 (amyA)
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KPR_3369 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
3458144..3459613
Genome map
AA seq 489 aa AA seqDB search
MQCFHWYYPTGGELWPEVEALAPSLNEIGINMVWLPPAYKGASGGYSVGYDTYDLFDLGE
FDQKGSVATKYGDKAQLLAAINALKEHNIAVLLDVVVNHKMGADEKEALRVQRVDEQDRT
QIDEEIIECEAWTRYTFPVRAGQYSQFVWDYKCFSGIDHIENPTEDGVFKIVNDYTGEGW
NEQVDDELGNFDYLMGANIDFRNHAVTEEIKYWARWVMEQTGCDGFRLDAVKHIPAWFYK
AWIEHVQEVAPQPLFIVEEYWSHEVEKLQQYIDLVEGKTMLFDAPLQMKFHEASRQGRDY
DMSQIFSGTLVEADPFHAVTLVTNHDTQPLQALEAPVEPWFKPLAYALILLRENGVPSVF
YADLFGASYEDTGGDGQTYAIEMPVIEQLHELIDARQRFAHGVQTLWFDHPNCIAFSRSG
TDDDPGCVVIMSNGDEGEKALTLGENYGNKRWRDFLGNREEIVETDGEGCATFTCNGGSV
SVWVLEEVL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatgttttcactggtactaccccaccggcggcgagctgtggcctgaggtcgaagcg
ctggcgcccagcctgaatgaaatcggcatcaatatggtctggttgccacccgcctacaaa
ggcgcctcgggcggttactccgtcggctatgatacctacgatctctttgacctcggcgag
tttgatcaaaaagggtctgtcgccaccaaatatggcgacaaagcgcagttgctggcggcg
atcaacgccctgaaggagcacaatatcgccgtgctgctggatgtagtggtcaaccataaa
atgggcgctgatgaaaaagaggctctgcgcgttcagcgcgtcgatgagcaggatcgtacg
caaattgacgaggaaatcattgagtgcgaggcatggacgcgctacaccttcccggtgcgc
gccggacagtattcgcagtttgtctgggactacaaatgttttagcggcattgaccacatc
gagaacccgacggaagacggtgtgtttaaaatcgtcaacgattacaccggcgaaggctgg
aatgaacaggtcgatgatgagctcggcaactttgactatctgatgggcgccaatatcgat
ttccgcaatcatgcagtgaccgaggagatcaaatactgggcgcgctgggtaatggagcag
accggctgcgacggttttcgtcttgacgcggtcaagcatatccccgcctggttttataaa
gcgtggatcgagcatgttcaggaggtggccccgcagccgctgtttattgtagaggaatac
tggtcccatgaagtggagaagctccagcagtatatcgacctggtcgagggcaaaacgatg
ctgtttgatgccccactgcagatgaaatttcatgaagcgtcgcgccagggccgcgattat
gacatgagccagattttcagcgggacgctggtcgaagccgaccctttccatgccgtcact
ctggtcaccaatcatgatacgcagccgctgcaggccctcgaggcgccggttgaaccctgg
ttcaagcccctcgcctatgcgctgatcctgctgcgggagaatggcgtgccctcggtcttt
tatgccgatctcttcggcgcttcctatgaggataccggcggcgacggacagacatatgcc
attgagatgcccgtcatcgaacaactccacgagctgatcgacgcccgtcagcgttttgcc
catggcgtgcaaaccctttggttcgatcatcctaactgcatcgcctttagtcgtagcggt
actgacgacgatccaggctgcgtggtgatcatgtccaatggcgatgagggcgaaaaggcg
ctgacgctgggcgaaaactatggcaacaaacgctggcgggattttctcggtaaccgggaa
gagattgtcgaaaccgatggcgaaggctgcgcgacctttacttgtaacggggggagcgtt
agcgtgtgggtgttagaggaggtgctgtag

DBGET integrated database retrieval system