KEGG   Klebsiella pneumoniae: KPR_3796Help
Entry
KPR_3796          CDS       T02793                                 

Gene name
ybhC
Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
kpr  Klebsiella pneumoniae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPR_3796 (ybhC)
   00500 Starch and sucrose metabolism
    KPR_3796 (ybhC)
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     KPR_3796 (ybhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
3906879..3908162
Genome map
AA seq 427 aa AA seqDB search
MNTYSVSRLALALAFGVTLSACSSTPADQQPSTQTAPGTTARPILNAEEAKNFTPAAYFQ
SLAPNAAAWTPSAISLPAQPDFIVGPAGTQGVTHTTIQAAVDAAIARHSNRRLYIAIMPG
EYPGTVYVPAAPGALTLYGTGDKPIDVKISEAIDSEMDRNTWRRLVNPGGKYMPGKPAWY
MFDSCQSKSAATVGVMCSAVFWSQNNGLQLQNLTIANNLGDSVDAGTHQAVALRSDGDQV
QINKVNILGRQNTFFVTNSGVQNRLQDNRQTRTLVTNSYIEGDVDIVSGRGAVVFDNTDF
RVVNSRTQKEAYVFAPATLKSVTYGFLATNSRFTASGDNVAQLGRALDVDGNSNGQVVIR
DSAINEGFNIAQPWAAAVGSGRPFSGNTGSADDKGNLQRNLNDNGFNRMWEYNNRGVGST
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatattccgtttcccgtctggcgctggcgctggccttcggcgtgacgctgtcc
gcctgtagctcgacgcctgccgatcaacagccctcaacgcagactgcaccgggcactacc
gcgcgtcccatactcaacgccgaagaagcgaaaaacttcacgccggcggcctatttccag
tcgctggctcccaacgccgccgcctggacgccgtctgctatcagcctgccggcgcagcct
gactttatcgtcggccctgcgggaacccagggcgtaacccataccaccattcaggcggcg
gtggatgcggcaattgcccgtcactctaaccgtcgtctgtatatcgcgattatgccgggc
gagtacccgggaaccgtctacgttccggcggcgccgggcgccctgaccctgtatggtact
ggcgataagccaatcgacgtgaaaatcagcgaagccattgattccgagatggatcgcaac
acctggcgtcgtctggtcaatccaggcggtaaatatatgccgggtaaaccggcgtggtat
atgttcgacagttgccaaagcaaatccgcggcgaccgtcggcgtaatgtgttccgcagtc
ttctggtcacagaataatggtctgcagctgcagaacctgaccatcgccaacaacctcggc
gacagcgttgacgccggtacccaccaggcggtggcattgcgcagcgatggcgaccaggtg
cagatcaataaggtcaatattcttggccgtcagaacaccttcttcgtgaccaacagcggc
gtgcaaaaccgtctgcaggacaaccgtcagacccgcaccctggtgaccaacagctacatt
gaaggcgatgtggatatcgtttccggccgcggcgcggtggtgtttgataacaccgatttc
cgcgtggtgaactcccgtacccagaaagaggcctacgtcttcgcgccggctactctgaag
agcgtgacctacggcttcctggcgaccaacagccgcttcaccgcctccggggataacgtc
gcgcagctcggccgcgcgctggacgtcgatggcaacagcaacggccaggtggtgatccgc
gacagcgctatcaatgaaggctttaatattgcccagccgtgggcggcggcggtaggctcc
ggccgcccgttcagcggcaacaccggcagcgccgatgacaaaggcaatctgcagcgcaac
ctcaacgacaacggcttcaaccgcatgtgggagtacaataaccgcggcgtgggaagcacc
gtggtcgccgagccgaaacagtaa

DBGET integrated database retrieval system