KEGG   Klebsiella pneumoniae: KPR_4165Help
Entry
KPR_4165          CDS       T02793                                 

Gene name
fucA
Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
kpr  Klebsiella pneumoniae
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPR_4165 (fucA)
Enzymes [BR:kpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KPR_4165 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(4294351..4294950)
Genome map
AA seq 199 aa AA seqDB search
MMSHQKRNAMERNRLARQIIDTCLEMTRLGLNQGSAGNVSVRYQGGMLITPTGIPYEKLT
EDKIVFIDADGQHEQGKLPSSEWRFHQAAYQTRPDAQAVVHNHAVHCTAVSILNRPIPAI
HYMIAAAGGNSIPCAPYATFGTRELSEHVAVALKHRKATLLQHHGLIACEASLEKALWLA
HEVEVLAQLYLSTLAITDP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcctggggttaaatcaggggagcgccggcaatgtcagcgtgcgctatcaggga
ggaatgctgatcacccctaccggtatcccatatgaaaagctgacggaagacaagatcgtc
tttattgatgccgacggccagcatgagcagggaaaactgccctccagcgaatggcgtttt
catcaggcggcctaccagacgcgacccgatgcccaggcggtggtccacaatcacgctgtc
cattgtacggcggtgtcgatcctcaaccggcccatcccggccattcactatatgatcgcc
gcggccggcgggaattcgatcccctgcgcgccctatgccaccttcggcacccgcgaactg
tctgagcatgtcgcggtggcgctgaagcaccgcaaagccacgctgctgcagcatcacggc
ctgatcgcctgcgaggccagcctggagaaagcgctctggctggcgcatgaagtggaggtc
ctggcccagctctacctcagtacgctggcgattaccgacccggtcccggtgctggatgac
gaggcgatcgccatcgtgctggagaagttcaaaacctacggattacgcattgaagagtga

DBGET integrated database retrieval system