KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_4165Help
Entry
KPR_4165          CDS       T02793                                 

Gene name
fucA
Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kpr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(4294351..4294950)
Genome map
AA seq 199 aa AA seqDB search
MMSHQKRNAMERNRLARQIIDTCLEMTRLGLNQGSAGNVSVRYQGGMLITPTGIPYEKLT
EDKIVFIDADGQHEQGKLPSSEWRFHQAAYQTRPDAQAVVHNHAVHCTAVSILNRPIPAI
HYMIAAAGGNSIPCAPYATFGTRELSEHVAVALKHRKATLLQHHGLIACEASLEKALWLA
HEVEVLAQLYLSTLAITDP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcctggggttaaatcaggggagcgccggcaatgtcagcgtgcgctatcaggga
ggaatgctgatcacccctaccggtatcccatatgaaaagctgacggaagacaagatcgtc
tttattgatgccgacggccagcatgagcagggaaaactgccctccagcgaatggcgtttt
catcaggcggcctaccagacgcgacccgatgcccaggcggtggtccacaatcacgctgtc
cattgtacggcggtgtcgatcctcaaccggcccatcccggccattcactatatgatcgcc
gcggccggcgggaattcgatcccctgcgcgccctatgccaccttcggcacccgcgaactg
tctgagcatgtcgcggtggcgctgaagcaccgcaaagccacgctgctgcagcatcacggc
ctgatcgcctgcgaggccagcctggagaaagcgctctggctggcgcatgaagtggaggtc
ctggcccagctctacctcagtacgctggcgattaccgacccggtcccggtgctggatgac
gaggcgatcgccatcgtgctggagaagttcaaaacctacggattacgcattgaagagtga

DBGET integrated database retrieval system