KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_4559Help
Entry
KPR_4559          CDS       T02793                                 

Definition
(GenBank) unnamed protein product; highly similar to glycoside hydrolase family 24 from Escherichia coli strain ATCC 8739 - DSM 1576 - Crooks (tr|B1IWU6)
  KO
K01185  
lysozyme [EC:3.2.1.17]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Brite
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     KPR_4559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4682871..4683380
Genome map
AA seq 169 aa AA seqDB search
MNPSTVKRCLVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCDAGVWTDGIG
NTSGVVQGKTITERQAAGSFITNVLRVEKALDRCVLVSVPQNVYDALVSLAFNVGTGNAC
SSTMVKFINQKRWRDACYQLPRWVYVKGVFNQGLENRRGRELAWCLKGA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaatccttcaaccgttaaacgctgcctggtaggggcggtgctggcgattgccgccacc
ctgccgggctttcagcaacttcatacctcagtggaagggttgaagctgatagccgattac
gagggctgccgcctgcagccgtatcagtgtgatgcgggggtgtggaccgatgggattggc
aatacctccggcgtggtgcaggggaagaccatcacggaacggcaggccgcagggagtttc
atcaccaacgttttaagggtggagaaggcactggatcgctgtgtcctggtgagcgtaccg
cagaacgtctatgacgcgctggtatcgctggccttcaacgtgggaaccggcaacgcctgc
agctcaaccatggtgaagtttatcaatcagaagcgctggcgtgatgcctgctatcagctg
ccgcgctgggtatatgtcaaaggcgtatttaatcagggcctggaaaaccgccgcgggcgg
gagctggcctggtgcttaaaaggagcgtaa

DBGET integrated database retrieval system