KEGG   Klebsiella pneumoniae: KPR_4588Help
Entry
KPR_4588          CDS       T02793                                 

Gene name
dsbC
Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
kpr  Klebsiella pneumoniae
Brite
Enzymes [BR:kpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KPR_4588 (dsbC)
Secretion system [BR:kpr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   KPR_4588 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(4709242..4709955)
Genome map
AA seq 237 aa AA seqDB search
MKKGLLMFTLLAASLSGAAHADSAAIKQSLAKLGVQSTDIQPSPVSGMSTVLTGSGVLYV
TDDGKHIIQGPMYDVSGAQPVNVTNQLLLGKLNALSNEMIVYNAPKEQHVITVFTDITCG
YCHKLHEQMSDYNALGITVRYLAFPRQGLQSQAEQDMKAIWCAKDRNKALDDAMNGKGVQ
PASCSVDIAKHYTLGVQMGVNGTPAMVLSNGMVLPGYQGPKELKAFLDEHKKQTSGN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttattgatgttcaccctgctggcggcctccctttcaggagcggcgcac
gccgatagcgcggcaattaaacagtcgctggcgaagctgggtgtgcagagcaccgatatt
caaccatcgccggtttccgggatgagcacggtgctgaccggcagcggcgtgctgtacgtg
accgacgacggcaagcatatcatccaggggccaatgtacgacgtgagcggcgcgcagccg
gtcaacgtcaccaaccagctgctgctgggtaagctgaacgcgctgagcaatgagatgatt
gtctacaatgcgccgaaggagcagcacgtcatcaccgtcttcaccgatattacctgcggc
tactgtcataaactgcacgagcagatgagcgactacaatgcgctggggatcaccgtgcgc
tatctggctttcccgcgccagggtctgcaaagccaggcggagcaggacatgaaggccatc
tggtgcgcgaaagatcgcaacaaagcgctggatgacgccatgaatggtaaaggcgtgcag
ccggcgagctgcagcgtagatatcgccaaacattacaccctcggcgtgcagatgggcgtc
aacggcaccccggcgatggtcctcagtaacggcatggtgctgccgggctatcaggggccg
aaagagctgaaggcgttcctcgatgagcacaaaaaacagacaagcggtaactga

DBGET integrated database retrieval system