KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_4938Help
Entry
KPR_4938          CDS       T02793                                 

Gene name
mutM
Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:kpr03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
5046217..5047026
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYLLSDVPVLSVRRRAKYLL
LELPDGWIIVHLGMSGSLRILSEELPAEKHDHVDLVMSNGKVLRYTDPRRFGAWLWTRTL
EGHPVLAHLGPEPLSDAFNADYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFSAG
IHPDRLASSLSREECEQLVKVIKLVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRICGTPVVGTKHAQRATFYCRQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaggttgaaaccagccgccgcggcatcgagccgcacctggttggc
gcaaccattctgcacgccgtcgtgcgcaacggacggctgcgttggccggtttccgaagag
atttatctcctgagcgacgttccggttctcagcgtgcgtcgccgcgccaaatacctgctt
ctggagctgccggacggctggatcatcgtccatcttgggatgtcggggagcctgcgcatc
ctgagcgaagagctgcctgctgaaaaacacgatcacgttgacctggtcatgagtaacggc
aaggtgctgcgctacaccgatccacgccgctttggcgcctggttgtggaccagaacgctg
gaaggccatccggtactggcccatcttggcccggagccgctcagcgacgcgttcaacgcc
gactatctccagcaaaaatgcgcgaagaagaaaaccgcgatcaaaccctggctgatggat
aacaagctggtggtgggcgtggggaatatctacgccagtgaatcgctgttctccgccggg
atccatcctgaccggctggcttcctcgctgtcgcgggaagagtgtgagcagctggtgaag
gtgattaagctggtcctgctgcgttcgatagagcagggcggcaccacgttaaaggatttc
ctgcaaagcgatggcaagccgggctatttcgcccaggagctacaggtctatggccgcaag
ggcgaaccctgccggatctgcggcacgccggtcgtcgggaccaaacatgcccagcgggcg
accttttattgccgtcagtgccagaagtag

DBGET integrated database retrieval system