KEGG   Klebsiella pneumoniae: KPR_4980Help
Entry
KPR_4980          CDS       T02793                                 

Gene name
malS
Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
kpr  Klebsiella pneumoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPR_4980 (malS)
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KPR_4980 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(5088298..5090331)
Genome map
AA seq 677 aa AA seqDB search
MKLAALATLFVPGMAFAAWTTTDFPAFTEEGTGRFISQKVVEKGTRPLQLNFDQQCWQPS
GGIKLNQMLSMEPCRGTPPQWRIFRQGLYTLEVDTRSGTPTMMISLEEKETSAAAPQIRQ
CPKWDGKPLTIDVSKTFAEGSKVRDFYSGNVATVSGGKITLQPAFGSNGLLLLERAETAA
PAPFDWHNATVYFVLTDRFVNGNPANDNSYGRHKDGMQEIGTFHGGDLQGLTSKLDYLQQ
MGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYTQDWSKLDANMGTEADLRRLVDEA
HKRGIRILFDVVMNHAGYATLADMQEFQFGSLYLQGDELKKTLGERWTDWKPGAGQTWHS
FNDYINFSDKAGWEKWWGKKWIRTDIGDYDNPGYDDLTMSLAFLPDLKTESKEVSGLPNF
YNHKPDTAAKAIPGYTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVEMDAWQQLKTQATAA
LAEWKKANPDKALDAAPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQDQAAKAATCMAN
IDLTWQQMADKLQSFNVLSYLSSHDTRLFREGGTTAAELLLLAPGAVQIFYGDESSRPFG
PTGSDPLQGTRSEMNWQDVNGKAARSVTHWQKIGQFRARHPAIGMGKQTTLSMPRGYGFV
RESGEDKVMVIWAGQQQ
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgctgcgcttgccacgttattcgtgcctgggatggcctttgccgcctggact
accaccgactttcctgcttttaccgaagaagggaccggccgattcatcagccagaaagtg
gttgagaagggtacacgtcccctgcagctaaattttgaccagcagtgctggcagccttcc
ggcggcattaagctcaaccagatgctgtccatggagccctgtcgcggcacaccgccgcaa
tggcgcatcttccgccagggtctgtataccctggaggtggatacccgttccggcacgcca
acgatgatgatttcgctggaggaaaaagagaccagcgccgcggcgccgcagatccgccag
tgtccgaagtgggacggaaaaccgctgaccatcgacgtcagcaaaaccttcgccgagggc
agcaaggtccgcgatttctacagcggcaatgtcgcgaccgtcagcggcggcaaaatcacc
ctgcagcccgccttcggcagcaatggactgctgctgcttgagcgcgccgagacggccgcc
ccggcgccgtttgactggcacaatgccaccgtctacttcgtcctgaccgatcgcttcgta
aacggtaacccggccaacgacaacagctatggtcgccataaagacggcatgcaggagatc
ggaaccttccacggcggcgacctgcagggattaaccagcaagctggattatctgcagcag
atgggagttaacgccctgtggatcagctccccgctcgagcagatccacggctgggtcggc
ggcggcacgaagggcgatttccctcactacgcttatcacggctattacacccaggactgg
tcgaaactggacgccaacatggggaccgaagcggatctccgccgactggtggatgaagcg
cataagcgcggaatacgtattctgttcgacgtggtgatgaaccatgccggctacgccacc
ctggccgacatgcaggagttccagttcggctccctgtatctgcaaggcgatgagctgaaa
aaaactctcggcgagcgctggacggactggaagccgggcgcgggacagacctggcacagc
tttaacgactatatcaacttcagcgacaaagccgggtgggagaaatggtggggtaagaag
tggatccgcaccgatatcggcgattacgacaatccgggctatgacgatctcaccatgtcg
ctggccttcctgccggacctgaaaaccgaatcgaaggaggtctcaggcctgccgaacttc
tataaccataaaccagacaccgcagcgaaagcgatcccgggctatacgccgcgcgactat
ctgacacactggctgagccagtgggtacgtgactacggcatcgatggcttccgcgtcgat
accgccaaacatgtggagatggacgcctggcagcagttaaaaacccaggccaccgccgcg
ctggcggagtggaagaaagccaatccggataaagcgctggatgcggcgccgttctggatg
actggcgaagcctggggacatggagtgatgcagagcgattattatcgccacggttttgat
gcgatgatcaatttcgactaccaggaccaggcggcgaaagcggcgacctgtatggccaat
attgacctcacctggcagcaaatggcggacaagctgcagagctttaacgtcctgagctac
ctctcctcgcacgatacgcggttgttccgcgaaggcggcaccaccgcggcggagctactg
ctgctggcccctggcgccgtgcagattttctatggcgacgaatcatcgcgcccgttcggc
cccaccggctcggacccgctgcagggtacccgctcggagatgaactggcaggatgtcaac
ggcaaggcggcccgcagcgttacccactggcagaagatcggccagttccgcgctcgccat
ccggcaatcggcatgggcaaacagacaacgctgtcgatgccacgtggttacgggttcgtg
cgtgagagcggtgaagacaaagtgatggtcatctgggccgggcagcagcagtaa

DBGET integrated database retrieval system