KEGG   Klebsiella pneumoniae: KPR_5023Help
Entry
KPR_5023          CDS       T02793                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kpr  Klebsiella pneumoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPR_5023
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KPR_5023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
5142083..5142625
Genome map
AA seq 180 aa AA seqDB search
MPLCALVAVIVTTVVMLVPRAWADTAWERYKARFMMPDGRIIDTANGNVSHTEGQGFAML
LAVANNDRPAFDKLWQWTDNTLRNKSNGLFYWRYNPVAPDPIADKNNASDGDTLIAWALL
RAQKQWQDKRYAIASDAITAALLKSTVVTFAGRQVMLPGVKGFNLNDHLNLNPSYFIFPA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtgtgctttagtggcggtgatagtgacaacggtagtgatgctggtgcccagg
gcgtgggcggatacggcctgggagcgctataaggcccgttttatgatgccggatggtcgt
atcattgataccgccaatggcaatgtgtcgcatacggaaggtcagggcttcgccatgctc
ctggcggtggcgaataacgatcgtccggcgttcgacaagctgtggcagtggacggacaac
accctgcgcaacaagtctaacgggttgttttactggcgctataacccggtggcgccggac
cctatcgccgataaaaacaacgcctccgatggcgataccctgatcgcctgggcgctgctg
cgcgcgcaaaaacagtggcaggataagcgctatgcgattgcctctgacgccatcaccgcc
gccctgctgaagtctacggtggtgactttcgccggtcgccaggtgatgctcccgggcgtg
aaagggttcaacctcaatgatcacctgaaccttaacccttcctatttcatcttcccggcc
tag

DBGET integrated database retrieval system