KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_5023Help
Entry
KPR_5023          CDS       T02793                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
5142083..5142625
Genome map
AA seq 180 aa AA seqDB search
MPLCALVAVIVTTVVMLVPRAWADTAWERYKARFMMPDGRIIDTANGNVSHTEGQGFAML
LAVANNDRPAFDKLWQWTDNTLRNKSNGLFYWRYNPVAPDPIADKNNASDGDTLIAWALL
RAQKQWQDKRYAIASDAITAALLKSTVVTFAGRQVMLPGVKGFNLNDHLNLNPSYFIFPA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtgtgctttagtggcggtgatagtgacaacggtagtgatgctggtgcccagg
gcgtgggcggatacggcctgggagcgctataaggcccgttttatgatgccggatggtcgt
atcattgataccgccaatggcaatgtgtcgcatacggaaggtcagggcttcgccatgctc
ctggcggtggcgaataacgatcgtccggcgttcgacaagctgtggcagtggacggacaac
accctgcgcaacaagtctaacgggttgttttactggcgctataacccggtggcgccggac
cctatcgccgataaaaacaacgcctccgatggcgataccctgatcgcctgggcgctgctg
cgcgcgcaaaaacagtggcaggataagcgctatgcgattgcctctgacgccatcaccgcc
gccctgctgaagtctacggtggtgactttcgccggtcgccaggtgatgctcccgggcgtg
aaagggttcaacctcaatgatcacctgaaccttaacccttcctatttcatcttcccggcc
tag

DBGET integrated database retrieval system