KEGG   Klebsiella pneumoniae: KPR_5031Help
Entry
KPR_5031          CDS       T02793                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kpr  Klebsiella pneumoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPR_5031
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KPR_5031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
5152275..5153384
Genome map
AA seq 369 aa AA seqDB search
MMKVLCGAVLSALLLAAGQVGAACQWPAWEQFKQAYVSPEGRVIDPSDARKISTSEGQSY
GLFFALAANDRAGFDKLLTWTQNNLAEGDLKQHLPGWLWGKKDDEQWTLLDSNSASDSDL
WIAWALLEAGRLWQQPQYTETGKALLARIVAEETVAVPGLGTMLLPGKVGFADDSGWRFN
PSYLPPQLATYFVRFGAPWPALRDSNLRLLLETAPKGFTPDWVRYEKGKGWQLKTEKPPI
GSYDAIRVYLWVGMLHDGDKQKARLLQRFTPMAAQTTKQGVPPEKVNIATGKTSGQGPVG
FSAAMLPFLQDDEARSVQRQRVADNYPGADAYYSAVLTLFGQGWDQHRFRFTASGELQPD
WNQECASSH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagtactttgtggcgcggtgctctcggcgctgctgctggcggcgggccaggtg
ggcgccgcctgccagtggcccgcctgggagcagtttaaacaagcgtacgtcagccccgag
ggacgggtgattgaccccagcgatgcgcgcaaaatctccacctccgaagggcagagctat
ggcctgtttttcgccctggcggccaacgatcgcgcggggttcgacaaactgctgacctgg
acgcagaacaacctggcggaaggcgatctgaaacaacatttgccgggctggctgtggggc
aaaaaggacgatgagcagtggaccctgctggacagcaactcggcgtccgactcggatctg
tggatagcctgggcgctgctggaggcggggcgcctgtggcaacagccgcagtacaccgag
accggaaaagccctgctggcgcggattgtcgctgaagagacggtggcggtaccgggcctc
ggcacgatgctactgccgggaaaagtcggttttgccgatgacagcggctggcggtttaac
cccagctatcttccgccgcagctggccacctactttgtgcgttttggcgcgccgtggccc
gctctgcgcgacagtaacctgcgcctgctgctggagaccgcgccgaaaggctttaccccg
gactgggtgcgctatgagaaagggaaaggctggcagctgaaaaccgaaaagccgccgatc
ggcagctatgacgcgattcgcgtctacctgtgggtgggcatgctccatgatggcgataag
cagaaagcgcgtctgctgcaacgcttcacgccgatggcggcgcagaccacgaagcagggg
gtacccccggagaaagtgaatatcgccaccggcaaaaccagcggtcaggggccagtgggc
ttctccgcggcaatgctgccgtttttacaggacgacgaggcccggtcggtgcaacgccag
cgcgtcgccgataactatcccggcgcggatgcctactacagcgcagttctgacgctgttc
ggccagggttgggatcaacaccgttttcgtttcacggcgagtggcgaattacaacctgac
tggaaccaggaatgcgcaagctctcactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system