KEGG   Klebsiella pneumoniae: KPR_5119Help
Entry
KPR_5119          CDS       T02793                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kpr  Klebsiella pneumoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPR_5119
Enzymes [BR:kpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     KPR_5119
Exosome [BR:kpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPR_5119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
5242438..5244624
Genome map
AA seq 728 aa AA seqDB search
MSNHIDRDVINALIAGHFADPFSVLGMHRTDAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDSRGFFSGVLPRRKNAFRYQLAVTWHGQQNLIDDPYRFGPLLQDLDVWLLSEGTHLR
PYETLGAHAATMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRFRKESGIWELFVP
GAHNGQLYKFELIDAHGNLRVKADPYAFESQMRPESASLICDLPPKVEQPADRRAANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPADDFALASFDGISLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWIERFGIDALRVDAVASMIYRDYSRKAG
EWIPNEYGGRENLEAIEFLRNTNRILGKQTPGAVTMAEESTDFAGVTRPPAGGGLGFWFK
WNLGWMHDTLDYMKLDPVHRRYHHDKMTFGMLYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWLFAFPGKKLLFMGNEFAQGREWNHDVSLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDPYGFEWLVVDDHERSVFVFVRRDRAGNEIIVASNFTPV
PRHDYRFGINQPGRWREALNTDSMHYHGSNQGNGGVVESDAIASHGREHSLSLTLPPLAT
IWLVREAQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcatattgatagagacgtgattaatgcgctaatcgccggtcatttcgcggat
cccttttccgtgctcggcatgcaccgtactgacgccgggctggaagtgcgcgcattatta
cccgatgccaccgacgtgtgggttattgaaccgaaaaccggacgcaaagtcggcaagctc
gaatgtctcgactcgcgtggtttcttcagcggcgtcctgccgcggcgtaaaaacgctttt
cgctatcagctggccgtcacctggcacgggcagcagaatctgatcgatgacccttatcgc
tttggtccgctgttgcaggaccttgacgtctggctgctgtcggaagggacccacctgcgc
ccttacgaaacgctgggcgcgcacgctgccaccatggacggcgtcaccggtacccgtttc
tcggtgtgggcgccgaacgcccgccgcgtatcggtggtggggcagtttaactactgggat
ggccgtcgccacccgatgcgattccgcaaagagtccgggatctgggagctgttcgttccc
ggcgcgcacaatggccagctgtataaattcgaactgattgacgcccacggcaatctgcgg
gtcaaagccgacccttacgcctttgagtcgcaaatgcgtccggaaagcgcctcgcttatc
tgcgacctgccgcccaaagtggaacagccagcggaccgcagagcggcgaaccagtttgat
gccccgatctctatctatgaagtgcatctcggctcctggcgccgtcataccgataataat
ttctggctgagctaccgcgagctggccgaccagctggtgccctatgcgaaatggatgggc
ttcacccatctcgaactattgccggttaacgagcacccgttcgacggcagctggggctat
caacccaccgggctctatgcgccgacccgccgcttcggcacccgcgacgatttccgttac
tttatcaatgccgcgcacgccgccgggctgaacgtcattcttgactgggtgcccggccac
ttcccggcggatgattttgcccttgcctcgtttgacggcatttcgctgtatgagcacagc
gatccgcgcgaggggtatcaccaggactggaataccctgatctacaactacggacgtcgg
gaagtcagcaactacctggtgggtaacgcgctgtactggatcgaacgcttcggcatcgat
gcgctgcgggtcgacgcggtggcctcgatgatctatcgcgattacagccgcaaggcggga
gagtggatccccaacgaatacggcggtcgggagaatctggaagccattgagtttctgcgc
aacaccaaccgcatccttggcaaacagacgccgggcgcggtcaccatggcggaagagtcc
accgattttgccggggtgacccgtccgccagccggcggcggcctcggtttctggttcaaa
tggaacctcggctggatgcacgacaccctggattacatgaagctcgatccggtgcatcgc
cgctaccatcatgacaaaatgaccttcggcatgctctacaactacaccgagaactttgtg
ctgccgctctcccacgatgaagtggtgcacggcaaaaaatcgattctcgaccgcatgccg
ggcgatgcctggcagaagttcgccaacctgcgcgcctactacggctggctgttcgccttc
ccggggaaaaagctgctgtttatgggcaatgagttcgctcaggggcgcgagtggaaccat
gacgttagcctcgactggcatctgctggagggcggcgacaactggcaccacggcgtccag
cggctggtgcgcgacctgaaccatacctaccgtcatcataaagcgctgcacgagctggat
tttgacccctacggcttcgaatggctggtggtcgacgaccatgagcgctcggtgtttgtc
tttgtacgccgtgaccgggcgggcaacgagattatcgtcgccagcaacttcacgccggtg
ccgcgccacgactaccgctttggcattaaccagccgggccgctggcgcgaggcgctaaat
accgactccatgcactatcacggcagcaatcagggcaatggcggcgtggtggaaagcgac
gctatcgccagccatggccgcgaacattcgctgtcgctgaccctgcccccgctggcgacg
atctggctggtccgggaggcgcaatga

DBGET integrated database retrieval system