KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_4877Help
Entry
VK055_4877        CDS       T03418                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:kpt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VK055_4877 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    VK055_4877 (thlA)
   00640 Propanoate metabolism
    VK055_4877 (thlA)
   00650 Butanoate metabolism
    VK055_4877 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    VK055_4877 (thlA)
   00072 Synthesis and degradation of ketone bodies
    VK055_4877 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VK055_4877 (thlA)
   00310 Lysine degradation
    VK055_4877 (thlA)
   00380 Tryptophan metabolism
    VK055_4877 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VK055_4877 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VK055_4877 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VK055_4877 (thlA)
Enzymes [BR:kpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VK055_4877 (thlA)
Exosome [BR:kpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VK055_4877 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(5005017..5005739)
Genome map
AA seq 240 aa AA seqDB search
MKNCVIVSAARTAIGSFNGALATTSAIDLGATVIKAALQRAQLDPQRVDEVIMGNVLQAG
LGQNPARQALLKSGLAETVCGFTVNKVCGSGLKSVALAAQAILAGQAQALVAGGMENMSQ
APYLLDAKARWGYRLGDGRLSDVILRDGLICATHGYHMGITAENVAKEYGISREMQDELA
LLSQRKALAAIDSGAFRAEIVPVSVTVKKRPFLNVMSFLKPTLRQKGLPLCVRPSTSLAQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagcgcggcgcgtaccgcaatcggcagttttaacggcgcg
ctggcgaccaccagcgccatcgacctcggcgctacggtaattaaggcagcccttcagcgc
gcgcagctcgatcctcagcgcgtggatgaagtgattatgggcaacgtcctacaggccggt
ctcgggcaaaacccggcccgccaggcgctgctcaaaagcggtcttgccgagacggtatgc
ggctttaccgttaacaaagtgtgcggctccggcctcaaaagcgtggcgctggccgcgcag
gcgattctggccggacaggcgcaagcgctggtcgcaggcggtatggaaaacatgagccag
gcgccgtacctgctggacgctaaagcccgctggggctaccgtctcggcgacgggcggctc
tccgacgtgatcctgcgcgacggtcttatctgcgccactcacggttatcatatggggatc
accgcagaaaacgttgctaaggaatacggcatcagccgggaaatgcaggatgagctggcg
ctgctttcacagcgtaaagcgcttgccgccatcgattccggcgcattccgggccgaaatt
gtgccggtcagcgtcaccgtaaaaaaacgaccatttttgaacgtgatgagtttcctaaag
ccgactctacgacagaagggcttgccgctttgcgtccggccttcgacaagtctggcacag
taa

DBGET integrated database retrieval system