KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_0011Help
Entry
KP1_0011          CDS       T00910                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KP1_0011 (rbsK)
Enzymes [BR:kpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KP1_0011 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11570..12499
Genome map
AA seq 309 aa AA seqDB search
MKTAGKLVVLGSINADHILNLDAFPTPGETVTGHHYQVAFGGKGANQAVAAGRSGADIAF
IACTGDDDIGERIRRQLASDKIDVAPVRAVAGEATGVALIFVNAEGENVIGIHAGANAAL
SVSQVEAEKERIASAQALLMQLESPLESVIAAAKIAHHHHTTVVLNPAPARELPDELLAL
VDIITPNETEAEKLTGIRVESDEDAAKAANVLHAKGIGTVMITLGSRGVWLSAEGESRRI
PGFRVQAIDTIAAGDTFNGALVTALLEGTALPEAIRFAHAAAAIAVTRKGAQPSVPWRTE
IDEFLAQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgcaggcaaacttgtcgtccttggcagtatcaatgccgatcacattcttaac
cttgacgctttcccgacgccgggcgaaaccgtcaccggccaccattatcaggtggcgttc
ggtggaaaaggggccaaccaggcggtggccgccgggcgcagcggagcggatatcgcgttt
atcgcctgcaccggcgatgacgatatcggtgaacgcatccgtcgtcagctggcgagcgat
aaaatcgacgtggcgcccgtgcgcgcggttgccggggaagcgaccggggtggcattaatt
ttcgttaacgccgaaggtgagaatgtcatcggtattcatgccggcgccaatgcggcgctt
tccgtctcccaggttgaggcggaaaaagagcgtatcgccagcgcacaggcgttgttgatg
cagctggagtcgccgctggagagcgtcatagcggcggcgaaaatcgcccatcaccatcac
accaccgtggtgctgaaccccgcgccagcgcgtgaactaccggatgaactgctggcgctg
gtggatattattacccctaacgaaaccgaagcggaaaagctgaccggtattcgcgttgag
agtgacgaagatgcggcaaaagccgccaacgtgctgcatgccaaaggcattggtacggtg
atgatcaccctcggcagccgcggcgtctggctcagtgccgaaggcgaaagccgccggatc
ccagggtttcgcgtacaggccattgatactatcgcggccggtgatacctttaacggcgcg
ctggtgaccgcgctgctggaagggaccgccctgccggaggcgattcgctttgcgcatgcc
gcagcggcgatcgccgtaacccgcaaaggcgctcagccgtccgtgccgtggcgcacagag
atcgatgaatttttagcgcaacaggggtaa

DBGET integrated database retrieval system