KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_0050Help
Entry
KP1_0050          CDS       T00910                                 

Definition
putative 6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KP1_0050
   01230 Biosynthesis of amino acids
    KP1_0050
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KP1_0050
   00030 Pentose phosphate pathway
    KP1_0050
   00051 Fructose and mannose metabolism
    KP1_0050
   00052 Galactose metabolism
    KP1_0050
  Energy metabolism
   00680 Methane metabolism
    KP1_0050
Enzymes [BR:kpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KP1_0050
Protein phosphatases and associated proteins [BR:kpu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KP1_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
50734..51786
Genome map
AA seq 350 aa AA seqDB search
MIFIANRRLVLREKCCQANERGCVMKIGIVISGGDVSGMNNFIFQIARQANADITLFNGG
IPGLLEKSHQDMAWRDLVDYSITAVPIITSGRTSRKLQRSEYESIAKKLKSLRIDVLIMA
GGDGSLQFLNTLSEFEINCFGVGMTIDNDVYGSDYTIGFSTACEQIIKEVSRLRNTGRAL
PGRVFMVEILGGYCGELTLQSAIKCNADIALIPEAQMPLAVLAERITRKLSTQNSVVILC
SEGYTKEYSPGFQGAIDTMIKQLEPQIGVRIRKTIVGYGLRSGDPTCEEIYQGTIMASEV
VRCIQSGMKNKAIIINSSNKPIPIDLVSMKKRLVDTEGHHYKLAKQLNII
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgatcttcattgcaaatagaaggcttgtactcagggaaaaatgttgtcaggcaaatgag
cgaggatgcgtcatgaaaattggtatcgttattagcggcggggatgtttctggaatgaat
aattttatattccagatagccaggcaggctaatgctgatatcacgctgtttaatggcggt
attccagggctactggagaaaagtcatcaggatatggcgtggcgcgatctggttgattat
tcaattaccgcggtgccgatcattacctcggggcgaaccagtcgcaaactgcagcgcagt
gaatatgaaagcattgctaaaaaacttaaatctctgcgtattgatgtgctcattatggcc
gggggggatggcagcctgcagtttctgaatacccttagtgaatttgagattaattgcttt
ggtgtgggaatgactatcgataatgatgtgtatggcagtgattatacgattggtttttcc
acggcctgtgagcaaattattaaagaagtctctcgtttaagaaataccggaagagcgctg
cccggtcgggtttttatggttgagatattaggaggctattgtggagaactaacgttgcag
tccgccattaaatgtaatgcggatattgccctgatcccggaggcacagatgccgttggcc
gtgctcgcggaacggattacccggaagctgagtacgcagaatagcgtcgttatcctctgc
tcagaaggctataccaaagagtactctcccggctttcagggggcgattgataccatgatt
aaacagctggaaccacaaataggtgtccgtatccgtaaaacgatcgtcggctatggttta
cgcagcggtgatccaacctgcgaagagatttatcagggcactattatggccagtgaagtg
gttcgctgtattcagtcaggtatgaaaaataaagccataataattaattccagtaacaaa
cctattccgattgatttagtcagtatgaaaaaacgtctggtcgatactgaaggacatcat
tataaacttgccaagcaactcaatattatttga

DBGET integrated database retrieval system