KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_0050Help
Entry
KP1_0050          CDS       T00910                                 

Definition
putative 6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:kpu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:kpu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kpu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:kpu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kpu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kpu00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:kpu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
50734..51786
Genome map
AA seq 350 aa AA seqDB search
MIFIANRRLVLREKCCQANERGCVMKIGIVISGGDVSGMNNFIFQIARQANADITLFNGG
IPGLLEKSHQDMAWRDLVDYSITAVPIITSGRTSRKLQRSEYESIAKKLKSLRIDVLIMA
GGDGSLQFLNTLSEFEINCFGVGMTIDNDVYGSDYTIGFSTACEQIIKEVSRLRNTGRAL
PGRVFMVEILGGYCGELTLQSAIKCNADIALIPEAQMPLAVLAERITRKLSTQNSVVILC
SEGYTKEYSPGFQGAIDTMIKQLEPQIGVRIRKTIVGYGLRSGDPTCEEIYQGTIMASEV
VRCIQSGMKNKAIIINSSNKPIPIDLVSMKKRLVDTEGHHYKLAKQLNII
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgatcttcattgcaaatagaaggcttgtactcagggaaaaatgttgtcaggcaaatgag
cgaggatgcgtcatgaaaattggtatcgttattagcggcggggatgtttctggaatgaat
aattttatattccagatagccaggcaggctaatgctgatatcacgctgtttaatggcggt
attccagggctactggagaaaagtcatcaggatatggcgtggcgcgatctggttgattat
tcaattaccgcggtgccgatcattacctcggggcgaaccagtcgcaaactgcagcgcagt
gaatatgaaagcattgctaaaaaacttaaatctctgcgtattgatgtgctcattatggcc
gggggggatggcagcctgcagtttctgaatacccttagtgaatttgagattaattgcttt
ggtgtgggaatgactatcgataatgatgtgtatggcagtgattatacgattggtttttcc
acggcctgtgagcaaattattaaagaagtctctcgtttaagaaataccggaagagcgctg
cccggtcgggtttttatggttgagatattaggaggctattgtggagaactaacgttgcag
tccgccattaaatgtaatgcggatattgccctgatcccggaggcacagatgccgttggcc
gtgctcgcggaacggattacccggaagctgagtacgcagaatagcgtcgttatcctctgc
tcagaaggctataccaaagagtactctcccggctttcagggggcgattgataccatgatt
aaacagctggaaccacaaataggtgtccgtatccgtaaaacgatcgtcggctatggttta
cgcagcggtgatccaacctgcgaagagatttatcagggcactattatggccagtgaagtg
gttcgctgtattcagtcaggtatgaaaaataaagccataataattaattccagtaacaaa
cctattccgattgatttagtcagtatgaaaaaacgtctggtcgatactgaaggacatcat
tataaacttgccaagcaactcaatattatttga

DBGET integrated database retrieval system