KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_0065Help
Entry
KP1_0065          CDS       T00910                                 

Definition
putative alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KP1_0065
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KP1_0065
  Lipid metabolism
   00071 Fatty acid degradation
    KP1_0065
  Amino acid metabolism
   00350 Tyrosine metabolism
    KP1_0065
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KP1_0065
   00626 Naphthalene degradation
    KP1_0065
Enzymes [BR:kpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KP1_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(62271..63419)
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIGDMVKLVAGKQWGKALIVTDGQLVKLGLLDSLFAALDEQQMA
YQLFDEVFPNPTEALVQQGYAAYQAARCDYLIAFGGGSPIDTAKAIKILTANPGLSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSERQVKEVIIDPNLIPDIAVDDASVML
DIPPAVTAATGMDALTHAIEAFVSVGAHPLTDANALEAIRLINLWLPKAVDDGHDLQARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIIENFNRPNAVARFA
RVAQAMGVDTRGMSDEAASMEAINAIRTLSKRVGIPQGFSQLGVSKADIEGWLDKALADP
CAPCNPRPASRDEVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagttttatgttggcactacctaaaatcagcctccacggcgcaggcgcgatcggtgat
atggtcaagctggtagcgggcaaacagtggggcaaggcgctgatcgtcaccgacggtcag
ctggtgaagctgggcctgctggacagcctgttcgccgcgctggatgaacagcagatggct
tatcagctatttgacgaggtattccccaaccccaccgaagcgctggtgcagcaaggctat
gcggcttaccaggcggcccgctgcgattacctgatcgccttcggcggcggtagcccgatt
gataccgccaaagcgataaaaatcctcaccgccaacccaggcctctccaccgcctactcc
ggcgtcggcaaagtgaaaaacgctggcgtgccgctggtggccatcaataccaccgccggc
acggcggcggagatgaccagcaacgcggtaattatcgatagcgagcggcaggtgaaagag
gtgattatcgacccgaacctgatcccggatatcgccgtcgacgacgccagcgtgatgctc
gacattccgccagccgttaccgccgccaccggcatggatgccctgacccacgccatcgag
gcctttgtctccgttggcgcccatccgctgaccgacgccaacgccctcgaggccattcgt
ctgattaacctgtggctgccgaaagcggtagacgatgggcacgatctgcaggcccgcgag
cagatggcctttggccagtatctggcaggcatggcgttcaacagcgccggtctcgggctg
gtacatgccctggcccatcagcctggcgccacccacaacctgccgcacggggtatgcaac
gccatcctgctgccgatcatcgaaaactttaaccgcccgaacgcggtggcgcgctttgcc
cgcgtggcgcaggcgatgggcgtcgatactcgcggcatgagcgatgaagctgccagcatg
gaggccatcaatgccatccgcacgctgagcaaacgcgtagggatcccccagggttttagc
cagcttggcgtcagcaaagccgatatcgaaggctggctggataaagcgctggccgaccca
tgcgcgccgtgtaacccgcgccccgccagccgcgatgaggttcgcgagctctatctggag
gccttatga

DBGET integrated database retrieval system