KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_0177Help
Entry
KP1_0177          CDS       T00910                                 

Gene name
pldA
Definition
(GenBank) outer membrane phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00564  Glycerophospholipid metabolism
kpu00565  Ether lipid metabolism
kpu00590  Arachidonic acid metabolism
kpu00592  alpha-Linolenic acid metabolism
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KP1_0177 (pldA)
   00565 Ether lipid metabolism
    KP1_0177 (pldA)
   00590 Arachidonic acid metabolism
    KP1_0177 (pldA)
   00591 Linoleic acid metabolism
    KP1_0177 (pldA)
   00592 alpha-Linolenic acid metabolism
    KP1_0177 (pldA)
Enzymes [BR:kpu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     KP1_0177 (pldA)
    3.1.1.32  phospholipase A1
     KP1_0177 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: BAH61084
Position
180729..181589
Genome map
AA seq 286 aa AA seqDB search
MRISLACLVALCALPAGVMAQDASVHDKPAVRGSIIANLLQDHDNPFLLYPYESNYLLYT
WTSDLNKEAIRSYDWAENARKDEVKFQLSLAFPLWRGILGDNSLLGASYTQKSWWQLSNS
KESAPFRETNYEPQLFLGFATDYQFAGWTLRDIEMGYNHDSNGRSDPTSRSWNRLYARLM
AQNGNWLVEVKPWYVVGNTDDNPDITKYMGYYRLKVGYQLGEAILSAQGQYNWNTGYGGA
ELGVSYPITKHVRAYTQIYSGYGESLIDYNFNQTRVGVGLMLNDLF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatctctttggcctgcctggtggcgctgtgcgcgctaccggccggtgttatggcg
caggacgcgtcggtacacgacaaaccggcagtgcgcggcagcattatcgccaacctgctc
caggaccatgataatcctttcctgctctacccttatgagagcaactatctgctctatacg
tggaccagcgacctcaataaagaggcgatccgcagctatgactgggccgaaaatgcccgt
aaagatgaagtgaagtttcagctaagcctggcgttcccgctgtggcgcggtatcctgggc
gataattcgctgctgggcgcgtcctatacccagaaatcctggtggcagctctctaacagc
aaagagtcggcgccgtttcgcgaaaccaattatgaaccccagctgtttttgggctttgcg
accgactaccagtttgccggctggacgctgcgcgatatcgagatggggtataaccacgac
tcgaatgggcgttccgaccccacctcgcgcagctggaatcggctttatgcccgcctgatg
gcgcaaaacggtaactggctggtggaagtgaagccctggtatgtggtgggcaacaccgat
gataacccggatatcaccaaatatatgggctattaccggctgaaggtgggctaccagctg
ggagaggcgatcctcagcgcgcaggggcaatacaactggaacaccggctacggcggggcg
gaacttggcgtgagctatcccattaccaaacatgttcgcgcctatacgcagatctacagc
ggctatggcgagtcgcttatcgactataactttaaccaaacgcgcgtcggcgtcgggcta
atgctcaacgatctgttttaa

DBGET integrated database retrieval system