KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_0203Help
Entry
KP1_0203          CDS       T00910                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KP1_0203 (fadB)
   01212 Fatty acid metabolism
    KP1_0203 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KP1_0203 (fadB)
   00650 Butanoate metabolism
    KP1_0203 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    KP1_0203 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    KP1_0203 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KP1_0203 (fadB)
   00310 Lysine degradation
    KP1_0203 (fadB)
   00380 Tryptophan metabolism
    KP1_0203 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KP1_0203 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KP1_0203 (fadB)
   00281 Geraniol degradation
    KP1_0203 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    KP1_0203 (fadB)
Enzymes [BR:kpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KP1_0203 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KP1_0203 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KP1_0203 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     KP1_0203 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(205469..207694)
Genome map
AA seq 741 aa AA seqDB search
MTRSYCWIQETDMLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEK
QSDLKGLLLRSEKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISA
VNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIA
AGKDVGADQALKIGLVDGVVAAEKLRDGALAILRQAMNGDLDWKAKRQPKLEPLKLSKIE
AAMSFTIAKGMVAQTAGKHYPAPITAVKTIEAAARLGREEALVLENKSFVPLAHTNEARA
LVGIFLNDQYVKAKAKKLTKDVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISDKS
LTLGMTEAAKLLNKQLERGKIDGLKLAGVISTIQPTLEYSGFDRVDVVVEAVVENPKVKK
AVLAETEAKVRPDTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGEK
TSDNTIAKVVAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVME
KQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLG
FWRYKDDSKGKPKKEEDAAVDSLLADVSQSKRDFSDEEIIARMMIPMVNEVVRCLEEGII
ASPAEADMALVYGLGFPPFHGGAFRWLDTIGSAKYLDMAQQYQHLGPLYEVPAGLRDKAR
HNEAYYPQVEPARPVGALKTA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaccagatcatattgctggattcaggagactgacatgctctacaaaggcgacaccctg
tacctcgactggctggaagatggcatcgccgaactggtgttcgatgccccaggttcggtc
aacaagcttgataccgcaaccgtagccagccttggtcatgcgctggacgtactggaaaaa
caaagcgatctcaaaggcctgctgctgcgctctgaaaaagcggcatttatcgtcggcgcg
gatatcaccgaattcctctcgctgttcctggtccctgaggagcagttaagccagtggctg
cattttgctaacagcgtcttcaatcgtctggaagatctccccgtccccacaatctctgcc
gtcaatggctatgcgctgggcggcggttgcgaatgtgtgctggcgaccgattaccgcctg
gcgacgccggatctgcgcattgggctgccggaaaccaagctcggcattatgcccggcttc
ggcggttccgtgcgtctgccgcgcctgctcggcgccgatagcgcgctggaaattattgcc
gccgggaaagacgtcggcgccgatcaagcactgaaaatcggcctggtggatggcgtggtc
gctgcggaaaaactacgcgacggcgcgctggcgatcctacgtcaggccatgaatggcgac
ctggactggaaagcgaaacgtcagccgaagctggagccgctgaagctcagcaaaattgaa
gccgccatgagcttcacgattgccaaaggcatggtcgcgcaaaccgccgggaagcattac
ccggcgccgatcaccgcggtcaaaaccattgaagccgccgcgcgtcttggtcgtgaagaa
gccctggtgctggaaaataaaagctttgtcccgctggcccataccaatgaggcccgcgcg
ctggttggtatcttcctgaacgaccagtacgtcaaagcgaaagcgaaaaagctgaccaaa
gatgtcgagacgccgaagcatgctgccgtcctgggcgctggcattatgggcggcggtatc
gcttaccagtcggcctggaagggcgtgccggtggtgatgaaagacatcagcgacaaatcg
ctgaccctgggcatgaccgaagcggcgaaactgctgaataaacagctggaacgcggcaaa
atcgacggtctgaagctggccggagtgattagcaccattcagccaaccctggaatacagc
ggttttgaccgcgtggacgtcgtcgttgaagcggtggtggaaaacccgaaagtgaagaaa
gccgtactagcggaaaccgaggcaaaagtgcgcccggataccgtgctggcgtccaacacc
tcaacgatccccatcagcgagctggccagcgttctgcagcgcccggaaaacttctgcggt
atgcacttctttaacccggtgcatcgcatgccgctggttgaagtgatccgcggcgaaaaa
acctcggataataccattgccaaagtggtggcctgggccagcaaaatgggcaaaacgccg
attgtggtgaatgattgtcccggcttcttcgtcaaccgggtactgttcccctacttcgcc
ggcttcagccagctgctgcgcgacggagcggacttccgcaaagtcgacaaagtgatggag
aaacagtttggctggccgatgggcccggcttatctactggacgtggtcggcatcgatacc
gcgcaccatgctcaggcggtcatggcggcgggcttcccgcagcggatgcagaaagattat
cgcgacgccatcgacgccctgtttgacgccaaccgtttcggccagaagaacggcctcggc
ttctggcgctataaagacgacagcaaaggtaagccgaagaaagaagaagatgctgccgtc
gacagcctgctggccgacgtcagccagtcgaagcgcgatttcagcgatgaagagattatc
gcccgcatgatgatcccgatggttaacgaagtcgtccgctgcctggaagaaggcattatc
gccagcccggcggaagcggatatggcgctggtatacggcctgggcttccctccgttccac
ggcggcgcattccgctggctggacaccatcggcagcgcgaagtatctcgatatggcacag
caataccagcaccttggcccgctgtatgaagtgccagccggtcttcgtgacaaagcgcgc
cataacgaagcgtattatccccaggtagagccagcccgtccggttggcgctctgaaaacg
gcttaa

DBGET integrated database retrieval system