KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_0254Help
Entry
KP1_0254          CDS       T00910                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:kpu01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:kpu00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
266251..267570
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELNKEWTNPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKLWR
LLHGEAKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPAN
SVPAVVDRINNTFRRADQIQWSAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDA
DAADLITSDCDPYDREFITGDRTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSKPDL
EQARRFAEAIHARFPGKLLAYNCSPSFNWKKNLDDKTIASFQQQLSDMGYKYQFITLAGI
HSMWFNMFDLAHAYAQGEGMRHYVEKVQQPEFAAGPEGYTFVSHQQEVGTGYFDKVTTII
QGGTSSVTALTGSTEEDQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacccaacaaatcgaagaattaaacaaagaatgg
acgaacccgcgctgggaaggcattacccgtccctacagcgcggaagaagtggtgaagtta
cgcggctcggtgaatccggaatgcacgctggcgcagcttggcgcggcgaaactgtggcgt
ctgctgcacggggaggcgaaaaaagggtacgtcaacagtctcggcgcgctgaccggcggc
caggccttgcagcaggcgaaggcgggtatcgaagccatttatctctccggctggcaggtg
gcggcggatgctaacctggcgtccagcatgtatccggatcaatcgctgtatccggccaac
tcggtaccggcggtggtggatcggatcaacaacaccttccgccgcgccgatcagatccag
tggtcagcgggaattgaaccgaacgatccgcgctttatcgactacttcctgccgatcgtg
gcggatgcggaggccggttttggcggcgtcctgaacgcctttgagctgatgaaatcgatg
attgaagccggtgcagcggctgttcacttcgaagatcagctggcatcggtgaagaagtgc
ggccatatgggcggtaaagtgctggttccgactcaggaggcgattcagaagctggtggcg
gcgcgtctggcggccgacgtgatgggggtcccgacgctggtcatcgcccgcaccgatgcc
gacgccgcggatttaattacctcagactgcgatccgtacgatcgtgagtttattaccggg
gatcgcaccagcgaagggttcttccgcacccacgccgggatcgagcaggcgatcagccgc
gggctggcctacgcgccgtatgcggatctggtgtggtgtgaaacgtcgaaaccggatctc
gagcaggcgcgccgctttgccgaggctatccatgcgcgtttcccgggcaaactgctggcc
tataactgctcgccgtcgtttaactggaagaaaaatctcgatgataaaaccatcgccagc
ttccagcagcagctgtcggacatgggatacaaataccagtttattaccctcgcggggatc
cacagcatgtggttcaacatgttcgacctcgcccatgcctacgctcagggtgaggggatg
cgccactatgttgagaaagtgcagcagccggaattcgccgccgggccggaaggctacacc
ttcgtctcgcatcagcaggaggtgggcaccggctacttcgacaaggtcaccaccattatc
cagggtggcacctcgtcggtaacggcgctgaccggctcgaccgaagaagatcagttttaa

DBGET integrated database retrieval system