KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_0797Help
Entry
KP1_0797          CDS       T00910                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KP1_0797 (deoA)
Enzymes [BR:kpu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     KP1_0797 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
775803..777194
Genome map
AA seq 463 aa AA seqDB search
MMPVGRIRRSRRHPAIYSLWEVTVFLAQEIIRKKRDGQALSDEEIRFFINGIRDNTISEG
QIAALAMTIFFHDMSMPERVSLTMAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLM
LGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQT
SSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELS
AALAEAIVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTM
ALCVEMLISGKLAADDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPSDFVENYANYLPTA
MLSKAVYADTEGFISAMDTRALGMAVVSMGGGRRQASDTIDYSVGFTEMARLGDRVDGQR
PLAVIHAKDENSWQEAAKAVKAAIKLDDKAPEITPTVYRRITE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcctgtaggccggataaggcgctcgcgccgtcatccggcaatttattctctttgg
gaggttaccgtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcaggcatta
agcgatgaagagatccgctttttcatcaacggcatccgcgacaatactatctctgaaggg
cagatcgccgcgctggcgatgaccatcttcttccacgatatgtctatgccggagcgcgtt
tcgctgaccatggcgatgcgggattccggtaccgttctggactggaaaagcctcaacctt
aacggtccaatcgtcgataaacactctaccggcggcgtcggggatgtcacttcgctgatg
ctggggccgatggtggccgcctgcggtggttacgtaccgatgatctccggccgcggcctc
ggccataccggcggtacgctggacaaactggaagcgatcccgggcttcgatatcttcccg
gacgacaaccgcttccgcgagattattaaagatgttggcgtggcaattatcgggcagacc
agctcccttgccccggccgacaaacgtttctatgccacccgcgatattaccgcgacggtg
gactccatcccgctgattaccgcctcgattctggcgaagaagctggcggaagggctggat
gcgctggtgatggacgtcaaagtcggcagcggcgcctttatgccgacttatgaactctct
gccgcgctggccgaagcgatcgtgggtgtcgccaacggcgccggcgtgcgcaccaccgcg
ctgctgaccgatatgaatcaggtactggcctccagcgccggcaacgccgttgaagttcgc
gaagcggtgcagttcctgaccggcgaatatcgcaacccgcgcctgttcgacgtgacaatg
gcgctgtgtgtggaaatgctgatctccggcaagctggcggcggacgatgccgaggcgcgc
gcgaagctgcaggcggtgctggataacggtaaagcggcggaagtgtttggccgcatggtc
gcggcgcagaaagggccgagcgactttgtcgagaattatgctaattatctgccgacggcg
atgctgagcaaagcagtctatgctgataccgaaggttttatcagcgcgatggatactcgc
gcgctgggcatggcagtggtttctatgggcggcggccgccgtcaggcatcggacaccatt
gactatagcgttggctttaccgagatggcgcgtctgggtgaccgcgtcgacggacagcgt
ccgctggcggtgatccatgccaaagacgagaacagctggcaggaggccgcgaaagcggtc
aaagcggccattaaactggacgataaagccccggaaattacaccgacagtctatcgccgt
atcactgaatag

DBGET integrated database retrieval system