KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_0907Help
Entry
KP1_0907          CDS       T00910                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:kpu00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:kpu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
890293..891780
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPNAPERILREMTLDSRVAASGDLFIAVQGHQADGRRYIPQAIAQGV
AAIIAEAQGEAKDGEIREMHGVPVIYLSQLNERLSALAGRFYHQPSQQLRLVGVTGTNGK
TTTTQLLAQWAKLLGETSAVMGTVGNGLLDKVVPTENTTGSAVDVQHVLSSLVGQGATFG
AMEVSSHGLVQHRVAALQFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSTHHCGQAIVN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATAVNYHDSGATIQFDSSWGKGEIE
SRLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRMEVFSAPGKPAVVVDYAH
TPDALEKALQAARLHCSGKLWCVFGCGGDRDKGKRPLMGAIAEEFADIVVVTDDNPRTEE
PRAIINDILAGMLDAGQAKVMEGRAEAVTNAVMQAKENDVVLVAGKGHEDYQIVGNRRLD
YSDRVTVARLLGAVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgacctactcgctccatgggtgccaaacgcaccggagcgc
attctgcgagagatgacgctggacagccgggtggctgcttccggcgatctctttatcgcg
gtacagggtcatcaggcggacgggcgtcgttatatcccgcaggcgatagcgcaaggtgtg
gctgccattattgctgaagcgcagggcgaagctaaagacggtgagatccgtgaaatgcac
ggcgtgccggttatctacctgagccagcttaacgaacgcttatcggcgctggccgggcgt
ttttatcatcagccgtcgcagcagctgcgtctggtgggcgtcaccggcaccaacgggaaa
accaccaccactcagctgctggcgcagtgggcaaagctgctcggcgaaaccagcgcggtg
atggggaccgtcggtaacggtctgctggataaagtcgttccaactgaaaacaccaccggt
tccgcggtggacgttcaacatgtgctctccagtctggtcgggcagggggctaccttcggc
gcgatggaagtctcctcccatggtctggtacagcaccgcgtagcggccctgcagtttgcc
gcctcggtgtttaccaatctcagccgcgatcatctcgactaccatggcgacatggagcac
tacgaagcggcgaaatggctgctgtactccacccatcattgcggtcaggccatcgtcaat
gctgacgatgaagtcggtcgtcgctggctggcaaaactgccggacgcggtggcggtatcg
atggaagatcatatcaacccgaattgccacggccgctggctaaaggccaccgcggtgaac
tatcacgacagcggggcgaccatccagtttgactccagctggggcaagggcgaaatcgaa
agccgcctgatgggcgcatttaacgtcagcaacctgctgctggcgctggccacgctgctg
gcgctgggctatccgctggccgatctgctgaagaccgcagcgcgtttacagccggtgtgc
ggccgtatggaagtgttcagcgcgccgggtaaacctgccgtggtggtggattatgcccat
acgcctgacgcgctggaaaaagcgctgcaggcggcacgcctgcactgcagcggcaagctg
tggtgcgtcttcggctgcggcggcgaccgcgacaaaggtaaacgtccgttgatgggcgct
atcgcggaagagtttgccgacatcgtggtcgttactgacgataacccgcgcaccgaagag
ccgcgggcgattatcaacgatattctggccggcatgctcgatgcaggtcaggcgaaggtg
atggaaggccgcgcggaagcggtgaccaacgccgtgatgcaggcgaaagagaacgacgtg
gtgctggtggcgggtaaaggccatgaagattaccagatcgtcggcaaccgccgtctggat
tattccgaccgcgtgaccgtcgcgcgtctgctgggagcggtagcatga

DBGET integrated database retrieval system