KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_0943Help
Entry
KP1_0943          CDS       T00910                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00010  Glycolysis / Gluconeogenesis
kpu00020  Citrate cycle (TCA cycle)
kpu00620  Pyruvate metabolism
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
kpu01120  Microbial metabolism in diverse environments
kpu01130  Biosynthesis of antibiotics
kpu01200  Carbon metabolism
Module
kpu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KP1_0943 (aceF)
   00020 Citrate cycle (TCA cycle)
    KP1_0943 (aceF)
   00620 Pyruvate metabolism
    KP1_0943 (aceF)
Enzymes [BR:kpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KP1_0943 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H NQRA HlyD_D23 HlyD_3 DUF1223
Motif
Other DBs
NCBI-ProteinID: BAH61764
Position
925743..927641
Genome map
AA seq 632 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGKLIMIFDSAEGAAAAAPAQEEKKEAAPAAAAPAAAAAAKEVHVPDIGGDEVE
VTEIMVKVGDTIAAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMIFEV
AGAAPAAAPAQAAAPAAAAPAAAAGVKDVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLIT
VEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAQAAAPAPAAA
PAQAAKPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILRE
DVQAYVKDAVKRAESAPAAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSR
NWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFTPVVFIMKAVAAALEQMPRFN
SSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELTTISKKARDGKL
TAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPIS
LSFDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagttggcgacaaagtagaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagattaaagtctcc
gtcggcgacaaaaccgagactggcaaactgattatgattttcgattccgccgaaggtgca
gccgccgctgcacctgcgcaggaagagaagaaagaagccgctccggccgccgctgctcca
gcggctgccgcggcagcgaaagaagttcacgtcccggatatcggcggcgatgaagtcgaa
gtcactgagatcatggttaaagtgggcgacaccatcgccgctgagcaatccctgatcacc
gtagaaggcgataaagcctctatggaagttccggcgccgttcgccggtaccgtcaaagag
atcaaaatcaataccggcgataaagtttccaccggctccctgattatgatcttcgaagtt
gcgggcgctgcgcctgcagccgctccggcacaggctgccgcgccggctgctgcggctccg
gctgccgcagcaggcgtgaaagatgttaacgtcccggacatcggcggcgacgaagttgaa
gtcaccgaagtgatggttaaagtcggcgataaagtcgcggcggaacagtccctgatcacc
gtagagggcgacaaagcctctatggaagttccggcgccgttcgcgggtaccgttaaagag
atcaaaatcagcaccggcgataaagtcaaaaccggttccctgatcatggtcttcgaagtg
gaaggcgctgcgcctgccgccgctccggctcaggctgctgcaccggcaccagctgctgcc
ccggctcaggccgctaagcctgccgctgcgccggctgcgaaagcagaaggtaaaagcgaa
ttcgctgaaaacgatgcctacgttcacgcgaccccgctgattcgccgcctggcgcgcgag
ttcggtgttaacctggcgaaagtgaaaggcaccggccgtaaaggtcgtatcctgcgcgaa
gacgttcaggcctacgtgaaagacgcggttaaacgcgctgaatccgcaccggcggctgcc
gctggcggcggtatcccgggcatgctgccgtggccgaaggttgacttcagcaagtttggc
gaagtcgaagaagtggagctgggtcgtatccagaaaatctctggcgccaacctgagccgt
aactgggtgatgatcccgcacgttacccacttcgacaaaaccgatatcaccgatctggaa
gcgttccgcaagcagcagaatgccgaagctgagaagcgtaaactggacgtgaaattcact
ccagtggtcttcatcatgaaagcggttgccgctgcgcttgagcagatgccgcgcttcaac
agctcgctctccgaagatggtcagcgcctgacgctgaagaaatacatcaacatcggtgtg
gcggtggataccccgaacggtctggtggttccggtcttcaaagacgtgaacaagaagagc
atcaccgagctgtctcgtgaattgaccaccatctcgaagaaagcgcgcgatggcaaactg
acggctggcgaaatgcagggcggttgcttcaccatctccagcattggcggcctgggtacc
acccacttcgcgccgattgttaacgcgccggaagtggccatcctcggcgtgtctaaatcc
gcgatggagccggtatggaatggtaaagagtttgtgccgcgcctgatgctgccgatctct
ctgtccttcgaccaccgcgtcatcgacggtgctgatggtgcccgcttcattaccatcatt
aacaacaccctgagcgacattcgccgcctggtgatgtaa

DBGET integrated database retrieval system