KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_1027Help
Entry
KP1_1027          CDS       T00910                                 

Gene name
ispC
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:kpu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1005889..1007091
Genome map
AA seq 400 aa AA seqDB search
MKQLTVLGSTGSIGCSTLDVVRHNPGRFSVAALVAGKNVDRMVEQCLEFTPRYAVMDDAQ
SAERLRTRLHEHGCRTEVLSGQQAAAEVAALDEVDQVMAAIVGAAGLVPTLAAIRAGKTV
LLANKESLVTCGRLFMEAVQQSGARLLPVDSEHNAIFQSMPETIQQHLGYADLARNGVSS
ILLTGSGGPFRETAVAELAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAQQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMGWPQRLNSGVKPLDFC
QLSNLSFSAPDYTRYPCLKLAMDAFDVGQAATTTLNAANEESVAAFLHGDIRFTDIAAVN
LAVLDKMDLQEPQSIDDVLVIDAEARAIAHQQLQRLVAQA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattaaccgttctcggttcgaccggctccattggctgtagcacgctggacgtg
gtgcgccataaccctggtcgcttttccgtcgccgcgctggtcgcggggaaaaacgttgac
cgtatggttgaacaatgcctggaatttaccccccgttacgcggtgatggacgatgcgcaa
agcgctgagcggttgcgcacccgtctgcatgagcatggctgtcgcaccgaggtgctaagc
ggccagcaggcggcggccgaggtcgcggcgctggatgaggtcgatcaggtcatggcggca
atcgtcggcgcggcgggactggtgccgacgctggcggcgatccgcgccgggaaaacggta
ttgttagcgaataaagaatcgctggtgacctgcggtcgcttattcatggaggcggtgcaa
cagtcgggggcgcgattgctaccggtcgatagcgagcataacgctatttttcagagtatg
ccggagacaattcagcagcatctgggatacgctgatcttgcccggaatggcgtctcgtca
atcctgctgaccggctccggtgggcctttccgcgagacggccgtggctgaactggcggcg
atgaccccggatcaggcctgccgtcatcccaactggtcgatggggcgcaagatctccgtc
gattcggccacgatgatgaacaaaggcctggaatatattgaagcgcgctggctgtttaac
gcctcggcccagcagatggaagtgctgatccatccgcagtcggtgatccactcgatggtt
cgctatcaggatggcagcgtgctggcccagcttggggagccggatatgcgcacgccgatc
gcccataccatgggctggccgcagcgactgaattccggcgttaaaccgctggacttctgt
cagttgagcaatctgagcttctccgcgccggactatacgcgatatccgtgcctgaagttg
gcgatggacgcgtttgacgtcggccaggccgcgaccacgacgctgaatgcggctaatgaa
gagtcggttgccgcgtttctgcatggcgatatccgctttaccgatattgcggcggttaac
ctggcggtgctggataagatggacctgcaggagccgcaaagcattgatgatgttctggtt
atcgacgccgaggcgcgcgcaatcgctcaccagcagctgcagcggttggttgcgcaggcg
taa

DBGET integrated database retrieval system