KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_1330Help
Entry
KP1_1330          CDS       T00910                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kpu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1283348..1283953
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQYSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEAESITEVILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKITF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaactcagcttatggaagcgctgcgctgtctgccgggcgtc
ggcccgaagtcagcgcagcgcatggcgtttaccctgctgcagcgcgatcgcagcggcggg
atgcgcctggcgcaggcgctgacgcgtgcgatgtcggagatcggccactgcgccgattgc
cgcaccttcaccgagcaggaggtgtgcaatatctgcagcaacccgcgtcgccaggaaaac
ggccagatctgcgtggtagagagtccggcggacatctatgccattgagcagaccgggcag
tattccggccgctacttcgtgctgatggggcacctgtcgccgctcgacggcatcgggcct
gatgacatcgggctcgatcgcctggagcaacggctggaggcggagtcgatcaccgaggtg
atcctcgccaccaacccgaccgttgagggcgaggcgacggccaactacatcgcagagctg
tgcgcgcagtatggcgtcgacgccagccgaatcgcccacggcgtgccggtgggcggcgag
ctggagatggtcgacggcaccacgctgtcccactccctggccggtcgccacaagattact
ttctga

DBGET integrated database retrieval system