KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_1542Help
Entry
KP1_1542          CDS       T00910                                 

Definition
putative carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KP1_1542
Enzymes [BR:kpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KP1_1542
Exosome [BR:kpu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KP1_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1483333..1484946)
Genome map
AA seq 537 aa AA seqDB search
MSQHGLHRRRRRWEIFLVFAVPGHRVTEESTMQATAKEFIIALDEGTTNAKAVVLDSRGK
VIVKFSQPLAIQTPRDGWVEQSGEALVTASLAVIASAVAHVGAENVAALAISNQRETAIG
WYRDSGEPINAAITWQCTRSAAFCDTLRHDRQEQRIKQATGLPIAPLFSASKMRWLLDAT
ADGRLRAERGEICLGTIDSWLLWNLTAGEAFCCDYSNAARTQLLNLHRGEWDDEMLALFG
IPRAALPDIKSSSGLFGHTKGLAAIPDGIPIMAMIGDSHAALFGHALGEAGCVKATYGTG
SSVMAPVKSAQCDIDALATTVAWHDGDQLVWGLEGNIPHTGDAVAWMADSTGLSELSAAE
LAHELNTLPASVDSTLGVYFVPALTGLGAPWWDDSARGVICGLSRGVKRAHLIRAALESI
TYQIADVVVAMRQHEEFTLTALMVDGGPTNNDWLMQYQADLLGCPVMRSDVPELSAIGAA
LLARKALHPGSTADLQAFLTEHSTFQPDMARHQRLQTRWQEWRHAVDRTLWKPDSPA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacatggcctgcacagacgcaggagacggtgggagatattcctcgtcttcgcg
gttccaggacaccgagtgaccgaggagagcacgatgcaggcgacagcaaaagagttcatc
attgccctggatgaaggcaccaccaacgccaaagcggtggtgctggatagccggggcaag
gttatcgtcaaattctcgcagccgctggcgatccaaacgccgcgcgacggctgggtggag
caatcgggcgaagcgctggttaccgcctcgctggcggtgatcgccagcgcggtggcccac
gttggcgcggaaaacgtcgccgcgctggccatcagcaaccagcgggaaaccgccatcggc
tggtatcgcgacagcggcgaaccgattaacgcggcgatcacctggcaatgcacccgcagc
gccgcgttctgcgatacgctgcgtcacgatcgtcaggaacagcgtattaaacaggccacc
ggcctgccgatcgccccgctattctcggcctccaaaatgcgctggctgctggatgcgact
gcggatggccgcctgcgcgccgaacgcggcgaaatttgcctcggcaccatcgacagctgg
ctgctgtggaatctgactgctggagaagccttctgctgcgactactccaatgccgcccgc
acccagctgctgaacctgcaccgcggcgagtgggacgacgagatgctggcgctgttcggc
attccgcgcgcggcgttgccggacattaaatcatcgagcggcctcttcggccataccaaa
ggactggccgccattccggacggtattccgatcatggcgatgatcggcgactcccacgcg
gcactgttcggccacgcgctcggcgaggcaggctgcgtcaaagccacctacggcaccggc
tcttcggtcatggccccggtcaaatcggcgcagtgcgatatcgacgcgctggcgaccact
gtcgcctggcacgatggcgaccagctggtgtggggcctggaagggaatattccccacacc
ggcgatgctgtcgcctggatggcggacagcaccggactgagcgaactctctgccgccgag
ctggcccatgagctgaataccctccccgcctccgtcgattcaaccctcggggtctacttc
gtgccggcgctgaccggtcttggcgcgccctggtgggacgacagcgcccgcggcgtgatt
tgcggcctgagtcgcggggtgaaacgcgcgcatctgatccgtgcggcgctggagtccatc
acctatcagatagccgacgtggtggtggcgatgcgtcagcatgaggagttcaccctgacg
gcgttgatggtggacggcgggccgaccaacaatgactggctgatgcaataccaggccgat
ctgctcggctgcccggtgatgcgcagcgacgtgccggagctgtccgccatcggcgcggcg
ttgctggcgcgcaaagcgctccatccggggtcgaccgccgatctgcaggccttcttaacc
gaacacagcacctttcagcccgacatggcccgccaccagcgtttacaaacgcgctggcag
gagtggcgccatgcggtcgaccgaacattatggaaaccggactcgccagcctga

DBGET integrated database retrieval system