KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_1542Help
Entry
KP1_1542          CDS       T00910                                 

Definition
putative carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:kpu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1483333..1484946)
Genome map
AA seq 537 aa AA seqDB search
MSQHGLHRRRRRWEIFLVFAVPGHRVTEESTMQATAKEFIIALDEGTTNAKAVVLDSRGK
VIVKFSQPLAIQTPRDGWVEQSGEALVTASLAVIASAVAHVGAENVAALAISNQRETAIG
WYRDSGEPINAAITWQCTRSAAFCDTLRHDRQEQRIKQATGLPIAPLFSASKMRWLLDAT
ADGRLRAERGEICLGTIDSWLLWNLTAGEAFCCDYSNAARTQLLNLHRGEWDDEMLALFG
IPRAALPDIKSSSGLFGHTKGLAAIPDGIPIMAMIGDSHAALFGHALGEAGCVKATYGTG
SSVMAPVKSAQCDIDALATTVAWHDGDQLVWGLEGNIPHTGDAVAWMADSTGLSELSAAE
LAHELNTLPASVDSTLGVYFVPALTGLGAPWWDDSARGVICGLSRGVKRAHLIRAALESI
TYQIADVVVAMRQHEEFTLTALMVDGGPTNNDWLMQYQADLLGCPVMRSDVPELSAIGAA
LLARKALHPGSTADLQAFLTEHSTFQPDMARHQRLQTRWQEWRHAVDRTLWKPDSPA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacatggcctgcacagacgcaggagacggtgggagatattcctcgtcttcgcg
gttccaggacaccgagtgaccgaggagagcacgatgcaggcgacagcaaaagagttcatc
attgccctggatgaaggcaccaccaacgccaaagcggtggtgctggatagccggggcaag
gttatcgtcaaattctcgcagccgctggcgatccaaacgccgcgcgacggctgggtggag
caatcgggcgaagcgctggttaccgcctcgctggcggtgatcgccagcgcggtggcccac
gttggcgcggaaaacgtcgccgcgctggccatcagcaaccagcgggaaaccgccatcggc
tggtatcgcgacagcggcgaaccgattaacgcggcgatcacctggcaatgcacccgcagc
gccgcgttctgcgatacgctgcgtcacgatcgtcaggaacagcgtattaaacaggccacc
ggcctgccgatcgccccgctattctcggcctccaaaatgcgctggctgctggatgcgact
gcggatggccgcctgcgcgccgaacgcggcgaaatttgcctcggcaccatcgacagctgg
ctgctgtggaatctgactgctggagaagccttctgctgcgactactccaatgccgcccgc
acccagctgctgaacctgcaccgcggcgagtgggacgacgagatgctggcgctgttcggc
attccgcgcgcggcgttgccggacattaaatcatcgagcggcctcttcggccataccaaa
ggactggccgccattccggacggtattccgatcatggcgatgatcggcgactcccacgcg
gcactgttcggccacgcgctcggcgaggcaggctgcgtcaaagccacctacggcaccggc
tcttcggtcatggccccggtcaaatcggcgcagtgcgatatcgacgcgctggcgaccact
gtcgcctggcacgatggcgaccagctggtgtggggcctggaagggaatattccccacacc
ggcgatgctgtcgcctggatggcggacagcaccggactgagcgaactctctgccgccgag
ctggcccatgagctgaataccctccccgcctccgtcgattcaaccctcggggtctacttc
gtgccggcgctgaccggtcttggcgcgccctggtgggacgacagcgcccgcggcgtgatt
tgcggcctgagtcgcggggtgaaacgcgcgcatctgatccgtgcggcgctggagtccatc
acctatcagatagccgacgtggtggtggcgatgcgtcagcatgaggagttcaccctgacg
gcgttgatggtggacggcgggccgaccaacaatgactggctgatgcaataccaggccgat
ctgctcggctgcccggtgatgcgcagcgacgtgccggagctgtccgccatcggcgcggcg
ttgctggcgcgcaaagcgctccatccggggtcgaccgccgatctgcaggccttcttaacc
gaacacagcacctttcagcccgacatggcccgccaccagcgtttacaaacgcgctggcag
gagtggcgccatgcggtcgaccgaacattatggaaaccggactcgccagcctga

DBGET integrated database retrieval system