KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_1689Help
Entry
KP1_1689          CDS       T00910                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00020  Citrate cycle (TCA cycle)
kpu00640  Propanoate metabolism
kpu00660  C5-Branched dibasic acid metabolism
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
kpu01120  Microbial metabolism in diverse environments
kpu01130  Biosynthesis of antibiotics
kpu01200  Carbon metabolism
Module
kpu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KP1_1689 (sucC)
   00640 Propanoate metabolism
    KP1_1689 (sucC)
   00660 C5-Branched dibasic acid metabolism
    KP1_1689 (sucC)
Enzymes [BR:kpu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     KP1_1689 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A BAT
Motif
Other DBs
NCBI-ProteinID: BAH62432
Position
1634915..1636081
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDANGQPVNQILVEAATDIDKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKIAIDPLAGPMPYQGRELAFKLGLEGKQVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccggcgccg
gtgggttatgcctgtactactccgcgtgaagcagaagaagccgcttcaaaaatcggcgcg
ggtccgtgggtagtgaaatgtcaggttcacgctggtggccgcggcaaagcgggcggtgtg
aaagtagttaagagcaaagaagagatccgcgcatttgccgagcactggctgggcaaacgt
ctggtgacctatcaaacagatgcgaacggccagccggttaaccagatcctggttgaagcg
gcgaccgatattgacaaagagctgtacctgggcgcggttgttgaccgtagctcccgtcgt
gtggtgttcatggcgtctaccgaaggcggcgtggaaatcgagaaagtggcggaagagacc
ccgcacctgatccacaagatcgccatcgatccgctggcgggcccgatgccttaccagggt
cgtgaactggcgttcaaactgggtctggaaggtaaacaggttcagcagttcaccaagatt
ttcatgggtctggcgaccattttccttgagcgcgacctggcgctgatcgagatcaacccg
ctggtgatcaccaagcagggcgacctgatctgcctcgacggcaaactgggcgcggacggc
aacgcgctgttccgccagccggatctgcgcgaaatgcgcgatcagtctcaggaagaccca
cgtgaagcgcaggcggcgcagtgggaactgaactacgtcgcgctggacggcaacatcggc
tgcatggttaacggcgcaggcctggcgatgggtaccatggacatcgttaagctgcacggc
ggcgaaccggctaacttcctcgacgtaggcggcggcgcgaccaaagagcgcgtgaccgaa
gcgttcaaaatcatcctctctgacgacaacgttaaagcggtgctggttaacatcttcggc
ggcatcgtgcgttgcgacctgatcgctgacggcatcatcggcgcggtagcggaagtaggg
gttaacgttccggttgtggttcgtctggaaggtaacaacgccgaactgggcgcgaaaaaa
ctggctgacagcggcctgaatattattgcagcgaaaagtctgacggacgcagcacagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system