KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_2096Help
Entry
KP1_2096          CDS       T00910                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kpu00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:kpu00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2039728..2040750
Genome map
AA seq 340 aa AA seqDB search
MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDLAQLRELVRQIRDASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAAEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHEDPQKALTMARHFIDGMHAAGMKTTGKHFPGHGAVTADSHKETP
FDPRAASVIRDHDMAVFKSLIAEQRLDAIMPAHVIYPELDPRPASGSAYWLKTVLRGELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TKLYHKGSFSRQELRDSARWKTVSAQLEQLHARWQEAKSA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtgatgttggatgtcgaagggtatgagctggatgcggaagagcgagaaatt
ctggcgcatccgctggtgggagggttgatcctctttacccgaaattatcacgatctggcg
cagctgcgcgagctggtgcgccagatccgcgacgcctcccggaaccacctggtggtggcg
gtcgatcaggaaggggggcgggttcagcgtttccgcgaagggtttacccgtttaccggcg
gcccagtctttcgccgcgctgctggggatggaagaggggggcaaactggccgccgaagcc
ggctggctgatggccagcgaaatgatcgccatggatatcgatattagttttgcgccagtg
ctggacgtcggccatatcagcgccgcaatcggcgaacgttcttatcatgaagatccacag
aaagcgctgacgatggcgcgtcacttcattgacgggatgcacgccgcgggcatgaaaacc
accggcaaacacttcccgggtcacggggcggtgactgccgattcgcacaaagagacgccg
ttcgatccgcgggcggcatcggttatccgcgaccatgatatggcggtgttcaaaagcctt
atcgccgagcagcgtctggatgccattatgccggcgcatgtgatttacccggagctcgat
ccgcgtccggccagcggctcggcgtactggctgaaaacggtgctgcgcggcgaactgggc
tttgacggggtgattttctccgacgatctgtcgatggaaggggcggcgatcatgggcagc
tatgccgaacgcggtcaggcatcgctcgacgccggttgcgatatgatcctcgtctgcaat
aatcgtaaaggcgcggtcagtgtgctggataacctgtcgccgatcaaagcagagcgtgtt
acgaaattgtatcataaaggttccttttcccgtcaggagttaagggattcagcccgttgg
aaaacggtgagtgcccagctggagcagcttcatgcgcgctggcaagaggcgaagtccgcg
taa

DBGET integrated database retrieval system