KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_2096Help
Entry
KP1_2096          CDS       T00910                                 

Gene name
nagZ
Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00520  Amino sugar and nucleotide sugar metabolism
kpu01100  Metabolic pathways
kpu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KP1_2096 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    KP1_2096 (nagZ)
Enzymes [BR:kpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     KP1_2096 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: BAH62807
Position
2039728..2040750
Genome map
AA seq 340 aa AA seqDB search
MGPVMLDVEGYELDAEEREILAHPLVGGLILFTRNYHDLAQLRELVRQIRDASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAAEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSYHEDPQKALTMARHFIDGMHAAGMKTTGKHFPGHGAVTADSHKETP
FDPRAASVIRDHDMAVFKSLIAEQRLDAIMPAHVIYPELDPRPASGSAYWLKTVLRGELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TKLYHKGSFSRQELRDSARWKTVSAQLEQLHARWQEAKSA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtgatgttggatgtcgaagggtatgagctggatgcggaagagcgagaaatt
ctggcgcatccgctggtgggagggttgatcctctttacccgaaattatcacgatctggcg
cagctgcgcgagctggtgcgccagatccgcgacgcctcccggaaccacctggtggtggcg
gtcgatcaggaaggggggcgggttcagcgtttccgcgaagggtttacccgtttaccggcg
gcccagtctttcgccgcgctgctggggatggaagaggggggcaaactggccgccgaagcc
ggctggctgatggccagcgaaatgatcgccatggatatcgatattagttttgcgccagtg
ctggacgtcggccatatcagcgccgcaatcggcgaacgttcttatcatgaagatccacag
aaagcgctgacgatggcgcgtcacttcattgacgggatgcacgccgcgggcatgaaaacc
accggcaaacacttcccgggtcacggggcggtgactgccgattcgcacaaagagacgccg
ttcgatccgcgggcggcatcggttatccgcgaccatgatatggcggtgttcaaaagcctt
atcgccgagcagcgtctggatgccattatgccggcgcatgtgatttacccggagctcgat
ccgcgtccggccagcggctcggcgtactggctgaaaacggtgctgcgcggcgaactgggc
tttgacggggtgattttctccgacgatctgtcgatggaaggggcggcgatcatgggcagc
tatgccgaacgcggtcaggcatcgctcgacgccggttgcgatatgatcctcgtctgcaat
aatcgtaaaggcgcggtcagtgtgctggataacctgtcgccgatcaaagcagagcgtgtt
acgaaattgtatcataaaggttccttttcccgtcaggagttaagggattcagcccgttgg
aaaacggtgagtgcccagctggagcagcttcatgcgcgctggcaagaggcgaagtccgcg
taa

DBGET integrated database retrieval system