KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_2114Help
Entry
KP1_2114          CDS       T00910                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KP1_2114
   01230 Biosynthesis of amino acids
    KP1_2114
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KP1_2114
   00051 Fructose and mannose metabolism
    KP1_2114
   00562 Inositol phosphate metabolism
    KP1_2114
Enzymes [BR:kpu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KP1_2114
Exosome [BR:kpu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KP1_2114
  Exosomal proteins of bladder cancer cells
   KP1_2114
  Exosomal proteins of melanoma cells
   KP1_2114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2058648..2059442)
Genome map
AA seq 264 aa AA seqDB search
MTPIWLGTSWKMNKPLSQAMAWCETLAARMPEGCHPAIQPFVIPPFTAIQPVSHFLQTHQ
LPLLTGAQNMHEADQGAWTGEISAAMLAETGATLVELGHSERRAAFNESDAAINRKVHSA
LGHGLRPLICIGDSAEEKRWQVSRESVVRQMKIALYGLSHQQALRTLIAYEPVWAIGEHG
TPASPQEAGVIHQALRQALCERFGHETGTRIPLLYGGSVTLQNAVELLRQQEINGLFIGR
AAWDAQGYCDIVQRVTQEFILQAQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgatatggttaggaaccagctggaaaatgaacaagccgctgtcccaggccatg
gcctggtgcgaaacgctggcagcgcggatgccggagggctgtcaccctgctattcagccc
ttcgtcattccccccttcaccgcgatccaacccgtcagccattttctgcaaacgcatcag
ttaccgcttctgaccggcgcgcagaatatgcatgaagcggatcagggcgcctggaccggg
gaaatctcggcggccatgttggcagaaaccggcgccacacttgttgagctgggacattca
gaacgacgcgccgcctttaatgaaagcgatgccgcgattaatcgaaaagtgcatagcgcc
ttaggtcatggcctgcgcccgctgatctgtattggcgatagcgccgaggagaaacgctgg
caggtgtcgcgtgaaagcgtggtgcggcagatgaagatcgccctgtatggcctgagccac
cagcaggcgctgcggaccctgattgcgtatgaaccggtgtgggccattggcgaacatggt
acgcccgcctcaccgcaggaggcgggtgtcattcatcaggcgctacgtcaggcgctttgc
gagcggtttggtcacgagacgggaacccgtatcccgctgctctatggcggcagcgtaacg
ctgcaaaacgcggtggaattgctgcgccagcaggagatcaatgggttgtttatcggccgc
gcggcctgggacgcgcaaggctattgcgacattgttcaacgcgttacacaggaatttatt
ttgcaggcgcagtaa

DBGET integrated database retrieval system