KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_2477Help
Entry
KP1_2477          CDS       T00910                                 

Gene name
paaF
Definition
(RefSeq) enoyl-CoA hydratase-isomerase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    KP1_2477 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KP1_2477 (paaF)
   00650 Butanoate metabolism
    KP1_2477 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    KP1_2477 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KP1_2477 (paaF)
   00310 Lysine degradation
    KP1_2477 (paaF)
   00360 Phenylalanine metabolism
    KP1_2477 (paaF)
   00380 Tryptophan metabolism
    KP1_2477 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KP1_2477 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KP1_2477 (paaF)
   00281 Geraniol degradation
    KP1_2477 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KP1_2477 (paaF)
   00627 Aminobenzoate degradation
    KP1_2477 (paaF)
   00930 Caprolactam degradation
    KP1_2477 (paaF)
Enzymes [BR:kpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KP1_2477 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2380573..2381340
Genome map
AA seq 255 aa AA seqDB search
MSDLLIHRHGRVLQLTLNRPQARNALNNALLTQIAEALEAAAVDDSVGVCVIRGNARFFA
AGADLNEMAEKDLPATLDDIRPRLWARIDAFTKPLIASVNGYALGAGCELALLCDLIVAG
DNARFGLPEITLGIMPGAGGTQRLIRSVGKALASRMVLSGESIDARQAQQAGLVSDIHPA
ALTDEYALKLATTIARHSPLALRAAKQSLRLSQEVSLQAGLQQERQLFSLLSATEDRREG
IDAFLQKRTPEFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacctgctgatccaccgtcatggccgggtgcttcagttgacgctgaaccgcccg
caagcccgcaacgcgctgaacaatgccttattaacccagattgccgaggcgctggaggcc
gcggcagttgatgacagcgtcggcgtctgcgttattcgcggtaacgcgcgttttttcgcc
gccggggctgacctcaatgaaatggcggaaaaagatctgcctgccaccctggatgatatt
cgcccacggttatgggcgcgaatcgatgcttttactaagccgctcatcgcctcggtcaac
ggctacgcgctcggcgccggctgcgagctggctctgctgtgcgacctgattgtcgccggg
gacaacgcccgctttggcctgccggaaattaccctcggcattatgccgggcgcgggcggc
acccagcggctgatccgcagcgttggcaaggcgctggccagccggatggtgctgagcggc
gagagtattgacgcccgccaggcgcagcaggccgggctggtcagtgatatccatccggcg
gcgttaaccgatgagtatgccctgaaactggcaaccaccattgcccgccattcgccgctg
gcgctacgggcggcaaaacagtcgctgcgcctgtcgcaggaagtcagcctgcaggccggt
ctgcaacaggagcgccagctgtttagcctgctgagcgccaccgaggaccgccgcgaaggc
atcgacgccttcttacaaaaacgtaccccggaatttaaaggacgctaa

DBGET integrated database retrieval system