KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_3030Help
Entry
KP1_3030          CDS       T00910                                 

Definition
6-phospho-beta-glucosidase A
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KP1_3030
Enzymes [BR:kpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     KP1_3030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2890978..2892399
Genome map
AA seq 473 aa AA seqDB search
MFALLLHSLYHQTGSFFMAAFPHNFLWGAATAAYQVEGGHDADGKGPSIWDIYSHLPGTT
FEGTTGDIAVDHYHRFREDVALMAEMGLQSYRFSISWPRLLPAGRGKVNEAGVQFYSDLI
DELLAHNIEPMITLYHWDLPQALQDEGGWEARTTAEAFAEYARLCYARFGSRVKLWATFN
ETIVFIGHGYINGLHPPAVRDPARAIQACHHVFIAHALAVKAFREMAVAGEIGFVNVLQP
HTPLTDSEADIKATELADAIHTHWLYDPVLKGTYPADLLAQTQALWGVPRFAPGDDALLR
DNRCDFIGLNYYRRETVSAQPPEIATGGEPGVEGLFYFVRNPQSTYTEWGWEIWPQGLTD
GIMMIKARYGDIPIYITENGLGAKDPIIDGEVVDDPRIDYLSSHIGALEKALALGADVRG
YYPWSFIDLLSWLNGYQKQYGFVYVDHQQNLARKRKKSFYWYKSVIASHGEQR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgcttttattacactccctttatcatcagacagggagctttttcatggccgct
tttccgcacaatttcttatggggtgccgctaccgcagcgtatcaggttgagggaggacac
gacgccgacggtaaaggaccgtcaatctgggatatctactctcatctgccgggtaccacc
tttgaaggcaccaccggcgatattgccgtcgaccactatcaccgttttcgcgaagacgtg
gcgttaatggccgagatgggcctgcaaagctatcgattctccatctcctggccccgcctg
ctgcccgccgggcgcggtaaggtgaatgaagcgggagtccagttttacagcgatctgatc
gacgaactgctggcgcacaatattgagccgatgatcaccctctatcactgggatctgccg
caggccctgcaggatgagggcggctgggaagcgcgcactaccgccgaggccttcgccgag
tacgcccgcctgtgctatgcgcgctttggttcacgggtgaagctgtgggctaccttcaac
gaaaccattgtcttcattgggcacggctacattaacggcctccatcccccggcggtccgc
gatccggcgcgcgccattcaggcctgccaccacgtatttatcgcccatgcgctggcggtg
aaggcctttcgcgagatggctgtggccggcgagattggcttcgtcaacgtactgcaaccg
cataccccgctcaccgacagcgaggcggacattaaggccaccgaactggctgacgccatc
catactcactggctgtacgatccggtgctgaaaggcacctatcctgccgacctgctggcg
cagacccaggcgctgtggggggtacctcgctttgctccaggcgacgacgcgctgctccgt
gacaaccgctgcgactttatcggtctgaattactatcgccgggaaacggtatctgcccag
ccgcctgagatcgctaccggcggcgagcctggcgtggagggattattctatttcgtgcgt
aatccccagagtacatataccgaatggggctgggaaatctggccgcaggggctaactgac
ggcattatgatgattaaggcgcgctatggcgatattccgatatatatcaccgagaatggc
ctcggcgcgaaggacccgattattgacggggaagtggtcgacgacccgcggattgattat
ctcagcagccatattggcgccctcgaaaaagcgctggcgctgggggcagatgtgcgcggc
tattacccctggtcatttatcgatctgctgagctggctcaacggctaccaaaagcaatat
ggttttgtctatgtcgatcaccagcaaaatctggcgcggaaacgaaagaagagtttttat
tggtacaaatctgttattgccagtcacggcgaacagcgttaa

DBGET integrated database retrieval system