KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_3134Help
Entry
KP1_3134          CDS       T00910                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:kpu00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:kpu00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2976160..2976930
Genome map
AA seq 256 aa AA seqDB search
MNLHGKTALVTGSTSGIGLGIAKVLAQAGAQLVLNGFGDSSHARAEVAALGKIPGYHDAD
LRDVGQIEAMMHYAESTFGGVDIVINNAGIQHVAPVEQFPVDKWNDILAINLSSVFHTTR
LALPGMRQRNWGRIINIASVHGLVASKEKSAYVAAKHAVVGLTKTVALETARSGITCNAI
CPGWVLTPLVQQQIDKRIAEGVDPEQASAQLLAEKQPSGEFVTPQQLGEMALFLCSDAAA
QVRGAAWNMDGGWVAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacggtaaaacggcgctggtcaccggctccaccagcggcatcggtttaggg
atcgccaaagtgctggcgcaggcaggcgcccagctggtgctcaatggcttcggcgacagc
agccacgcccgggctgaagtcgccgcgctgggcaagatccccggctatcacgacgccgac
ctgcgcgacgtcgggcagatcgaggcgatgatgcactatgccgaaagcaccttcggcggc
gtcgatatcgtgatcaataacgccggcatccagcacgtggccccggtggagcagttcccg
gtggacaaatggaacgatattctcgccatcaatctctccagcgtcttccacaccacccgc
ctggcgctgccgggtatgcgccagcgcaactgggggcgcatcatcaacattgcctcagtg
catggcctggtggcgtcgaaagagaaatcggcctacgtcgccgccaagcacgcggtggtc
gggctgaccaaaaccgtggccctggaaaccgcgcgtagcggcatcacctgcaacgccatc
tgccctggctgggtgctaaccccgctggtgcagcagcagatcgacaaacgcatcgccgag
ggggtcgacccggagcaggccagcgcccagctgctggcggaaaagcagccctccggggag
tttgtcaccccgcagcagctgggcgaaatggcactgtttctgtgcagcgacgccgccgcc
caggtgcgcggcgccgcatggaacatggatggcggctgggtggcgcagtaa

DBGET integrated database retrieval system