KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_3290Help
Entry
KP1_3290          CDS       T00910                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase II
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00010  Glycolysis / Gluconeogenesis
kpu00030  Pentose phosphate pathway
kpu00051  Fructose and mannose metabolism
kpu00052  Galactose metabolism
kpu00680  Methane metabolism
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
kpu01120  Microbial metabolism in diverse environments
kpu01130  Biosynthesis of antibiotics
kpu01200  Carbon metabolism
kpu01230  Biosynthesis of amino acids
Module
kpu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KP1_3290 (pfkB)
   00030 Pentose phosphate pathway
    KP1_3290 (pfkB)
   00051 Fructose and mannose metabolism
    KP1_3290 (pfkB)
   00052 Galactose metabolism
    KP1_3290 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    KP1_3290 (pfkB)
Enzymes [BR:kpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KP1_3290 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: BAH63907
Position
3120236..3121168
Genome map
AA seq 310 aa AA seqDB search
MTKIYTLTLAPSLDSATQTPQIYPEGKLRCSAPVFEPGGGGINVARAVTFLGGKATAIFP
VGGATGEHLAALLADEQVPVETVETRDWTRQNLHVHVAASGEQYRFVMPGAALTDDEFRR
LEEKVLTIEPGSLLVVSGSLPPGISVDNLMQLVKNAQQQGLRCIIDSSGDALAAALDVGN
IELVKPNQKELSALVQRDLSQPDDVRLAAQSLIQSGKVRRVVVSLGPQGALGVDASGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLAENASLEDMVRFGVAAGSAATINQGTRLCSRTNT
QKIYDYLCGR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatttacacgctcacgctggccccctcgctggatagcgccacgcaaacccca
cagatctacccggaaggcaaacttcgctgcagcgcgccggtatttgaacctggcggcggc
gggatcaacgtggcccgcgccgtgacctttctcggcggcaaagccaccgccattttcccg
gtcggtggcgctaccggcgagcatcttgccgccctgctggccgatgagcaggtgccggtc
gagaccgtcgaaacccgcgactggacgcggcaaaacctgcacgtccacgtggccgccagc
ggcgaacagtatcgcttcgttatgcccggcgcggcactgacggacgatgaattccgccgt
ctggaagagaaggttctgactatcgaacccggctctctgctggtggtcagcggcagcctg
ccgccaggtattagcgtcgataatctgatgcaactggtgaaaaatgcgcaacagcaggga
ctgcgctgcatcattgacagttccggcgatgcgctggccgccgcgctggacgtcggcaat
attgagctggtgaaaccgaaccagaaagagcttagcgccctcgtgcagcgcgatctcagc
caacccgatgacgtgcgccttgccgctcagtcgttgatccagtccggtaaagtgcgccgg
gtggtggtctccctgggtccgcagggggcgttaggcgtggacgccagcggcagcgttcag
gtagtgccgccaccgatgaaaagccagagcaccgtcggcgctggcgacagcatggtgggc
gccatgaccttgcgtctggcggaaaacgccagccttgaagacatggtacgctttggcgtc
gccgccggtagcgccgcgaccatcaaccagggcacccgcctctgctcgcggaccaatacg
caaaaaatctatgattatctctgcgggcgttga

DBGET integrated database retrieval system