KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_3353Help
Entry
KP1_3353          CDS       T00910                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00900  Terpenoid backbone biosynthesis
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
kpu01130  Biosynthesis of antibiotics
Module
kpu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KP1_3353 (ispE)
Enzymes [BR:kpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     KP1_3353 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: BAH63966
Position
3181499..3182350
Genome map
AA seq 283 aa AA seqDB search
MMTRWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLTIEPRSDGQLRLLTPVAGV
PDEENLIVRAARLLMHAASESDRLPAGSGADISIDKRLPMGGGLGGGSSNAATVLVALNH
LWGCGLSEDELATLGLQLGADVPVFVRGHAAFAEGVGEILTPVEPEEKWYLVAHPGVSIP
TPIIFRDPELPRNTPRRSINTLLNCEFSNDCELIARKRFREVDAALSWLLEYAPSRLTGT
GACVFAEFNTESAARQVLDTAPAWLNGFVARGVNLSPLKQALL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccgctggccctctcctgcaaaactgaatctgtttttatatatcaccggccag
cgggccgatggttaccataccctgcaaacgctgtttcagtttctcgattacggcgatacg
ttgaccatcgaaccgcgtagtgacggccaactgcgtctgctgacgccggtggccggcgtg
ccggacgaggagaatctgatcgttcgcgccgcgcgtctgctgatgcatgccgccagcgaa
agcgatcgcctgccggcgggcagcggcgccgatatcagtatcgataagcgcctgccgatg
ggcggcggcctgggcggtggctcctccaatgccgccaccgtgctggtggcgctcaaccat
ctgtggggctgcggtctctcggaagatgagctggcgactcttggccttcagctgggggcc
gatgtgccggttttcgtgcgcggccatgccgccttcgccgagggggtgggtgaaatactg
acgccggtagaacccgaggaaaaatggtacctggtggcccacccgggggtcagtattccg
acgccgatcatttttcgcgatccggagctaccacgaaataccccgcgccggtcaattaat
acgttattaaattgtgaattcagcaacgattgcgagcttatcgcaagaaaacgttttcgc
gaggttgatgccgcgctttcctggctgttagaatatgcgccgtcacgcctgaccggcaca
ggggcctgtgtgtttgctgaatttaacaccgaatccgctgcccgtcaggtgctggacact
gccccggcatggctaaatggctttgtggcgcgcggagttaacctttcgccgctcaagcag
gccctgctctga

DBGET integrated database retrieval system