KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_3353Help
Entry
KP1_3353          CDS       T00910                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:kpu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3181499..3182350
Genome map
AA seq 283 aa AA seqDB search
MMTRWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLTIEPRSDGQLRLLTPVAGV
PDEENLIVRAARLLMHAASESDRLPAGSGADISIDKRLPMGGGLGGGSSNAATVLVALNH
LWGCGLSEDELATLGLQLGADVPVFVRGHAAFAEGVGEILTPVEPEEKWYLVAHPGVSIP
TPIIFRDPELPRNTPRRSINTLLNCEFSNDCELIARKRFREVDAALSWLLEYAPSRLTGT
GACVFAEFNTESAARQVLDTAPAWLNGFVARGVNLSPLKQALL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccgctggccctctcctgcaaaactgaatctgtttttatatatcaccggccag
cgggccgatggttaccataccctgcaaacgctgtttcagtttctcgattacggcgatacg
ttgaccatcgaaccgcgtagtgacggccaactgcgtctgctgacgccggtggccggcgtg
ccggacgaggagaatctgatcgttcgcgccgcgcgtctgctgatgcatgccgccagcgaa
agcgatcgcctgccggcgggcagcggcgccgatatcagtatcgataagcgcctgccgatg
ggcggcggcctgggcggtggctcctccaatgccgccaccgtgctggtggcgctcaaccat
ctgtggggctgcggtctctcggaagatgagctggcgactcttggccttcagctgggggcc
gatgtgccggttttcgtgcgcggccatgccgccttcgccgagggggtgggtgaaatactg
acgccggtagaacccgaggaaaaatggtacctggtggcccacccgggggtcagtattccg
acgccgatcatttttcgcgatccggagctaccacgaaataccccgcgccggtcaattaat
acgttattaaattgtgaattcagcaacgattgcgagcttatcgcaagaaaacgttttcgc
gaggttgatgccgcgctttcctggctgttagaatatgcgccgtcacgcctgaccggcaca
ggggcctgtgtgtttgctgaatttaacaccgaatccgctgcccgtcaggtgctggacact
gccccggcatggctaaatggctttgtggcgcgcggagttaacctttcgccgctcaagcag
gccctgctctga

DBGET integrated database retrieval system