KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_3726Help
Entry
KP1_3726          CDS       T00910                                 

Gene name
galF
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00040  Pentose and glucuronate interconversions
kpu00052  Galactose metabolism
kpu00500  Starch and sucrose metabolism
kpu00520  Amino sugar and nucleotide sugar metabolism
kpu01100  Metabolic pathways
kpu01130  Biosynthesis of antibiotics
Module
kpu_M00362  Nucleotide sugar biosynthesis, prokaryotes
kpu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KP1_3726 (galF)
   00052 Galactose metabolism
    KP1_3726 (galF)
   00500 Starch and sucrose metabolism
    KP1_3726 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    KP1_3726 (galF)
Enzymes [BR:kpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KP1_3726 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: BAH64302
Position
complement(3545674..3546570)
Genome map
AA seq 298 aa AA seqDB search
MNMANLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHS
SKNAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQAQPLGLGHSILCAR
PVVGDNPFVVVLPDIILDGGTADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQ
TKEPMVAEGQVARIVEFIEKPDEPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQL
TDAIAELAKKQSVDAMLMTGESYDCGKKMGYMQAFVTYGMRNLKEGAKFRESIKKLLA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggcgaatttgaaagcggttattccggtcgcaggactaggcatgcatatgctg
ccggccacaaaggcaattccaaaggagatgctgccgatcgttgataagccaatgattcag
tacatcgttgacgaaatcgtcgccgccgggatcaaagagattgttctggtgacgcactcc
tcgaagaacgcggtggaaaaccacttcgacacctcctacgagctggaagccctgctggaa
cagcgcgtgaagcgccagctactggcggaagtgcaggccatttgcccgccgggcgtgacc
atcatgaacgtgcgtcaggcgcagccgctgggcctgggccactctatcctctgcgcccgc
ccggtagtcggcgacaacccgtttgtggtggtcctgccggatatcatccttgacggcggc
accgctgacccgctgcgctataacctcgccgctatgatcgcccgctttaacgagaccggc
cgcagccaggtgctggcgaaacgcatgccgggcgatctctccgaatactccgtcatccag
accaaagagccgatggtggctgaaggccaggtggcgcgtatcgtcgagtttattgaaaaa
ccggacgaaccgcagaccctggactccgatctgatggcggtggggcgctacgtgctgtcg
gcggatatctgggccgaactggaacgtaccgagccgggcgcatggggccgtatccagctg
accgacgccattgccgaactggcgaagaagcagtccgtcgacgcgatgctgatgaccggc
gaaagctacgactgcgggaagaaaatgggctacatgcaggccttcgtcacctacgggatg
cgtaacctgaaagaaggcgccaaattccgcgaaagtattaaaaaactgctggcctga

DBGET integrated database retrieval system