KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_3803Help
Entry
KP1_3803          CDS       T00910                                 

Definition
putative phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kpu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3629747..3631141)
Genome map
AA seq 464 aa AA seqDB search
MKTFPTDFLWGGATAANQVEGAYLEDGKGLSTSDVQPHGVFGEVVERVPGDSGIKDVAID
FYHRYPEDIALFAEMGFNCLRVSIAWTRIYPNGDDAEPNEAGLAFYDKLFDEMAKHKITP
LVTLSHYEMPWALVKNYGGWGSREVIGFFERYARTVFSRYKNKVKLWLTFNEINMSLHAP
MTGVGLPAGSSKGEVYQAIHHQLVASALAVKACHELVPEGKIGNMLLGGLMYPLSCKPED
VFETLQENRSWQFFGDVQARGAYPGYMQRYFRDNGITLTITDADREALKTTVDFISFSYY
MTGCVTADEALNQQARGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKVEADGSINDDYRISYLNDHLVQAREAIDDGVELMGFTSWGPIDLVSASKAE
LSKRYGFIYVDRHDDGTGTLARSKKKSFGWYKEVIASRGASLKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcccgacggattttttatggggcggcgcgaccgcggccaatcaggtggaa
ggtgcttatctggaagatggcaaaggcttatccacctccgatgtgcagccgcacggcgtg
ttcggcgaagtggtcgagcgcgtacccggcgacagcggcataaaagatgtggcgatcgat
ttttaccatcgctatccggaagatattgccctgtttgccgagatgggctttaactgcctg
cgagtctccatcgcctggacccgcatctaccccaacggcgacgacgccgagccgaacgaa
gccggcctcgcgttctacgacaagctgttcgacgagatggcgaagcacaagatcaccccg
ctggtgacgctgtcgcattatgaaatgccatgggcgctggtaaaaaactacggcggctgg
ggcagccgggaggtgattggcttctttgagcgctacgcccggacggtgttcagccgctat
aaaaataaggtcaaactgtggctgacctttaacgaaatcaatatgtcgctgcatgccccg
atgaccggcgtcggcctgccggccggcagcagcaaaggcgaggtgtatcaggcgattcac
caccagctggtggccagcgcgctggcggtcaaagcctgtcatgagctggtgcctgagggc
aaaatcggcaatatgctgctcggcgggctgatgtatcccctgagctgcaaaccggaggat
gtgttcgagacgctgcaggagaaccgcagctggcagttctttggcgacgtacaggcgcgc
ggcgcgtacccgggctatatgcagcgctatttccgtgacaacggcatcacgctcaccatc
accgacgccgatcgtgaagcgctaaaaaccaccgtcgactttatctccttcagctactac
atgaccggctgcgtcaccgccgacgaggcgctgaaccagcaggcgcgcggcaatattctc
agcatggtgccgaacccgcacctggcgagctcggagtggggctggcagatagacccgctg
ggcctgcgcacgctgctgaacgtgctgtgggatcgctaccagaagccgctgtttatcgtg
gaaaacggtctgggcgccaaagataaggtggaagccgacggcagcattaacgatgactac
cgcatcagttacctgaacgaccacctggtgcaggcgcgggaagccattgacgatggcgtt
gagctgatgggctttaccagctggggaccgattgacctggtgagcgcctcaaaggcggag
ctgtcgaagcgctacggctttatctatgtcgaccgccatgatgacggtaccggcaccctg
gcgcgcagtaagaagaagagctttggctggtataaagaggtgattgccagccgcggcgcc
agcctgaaagcctaa

DBGET integrated database retrieval system