KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_4232Help
Entry
KP1_4232          CDS       T00910                                 

Definition
putative arginase/agmatinase/formiminoglutamase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kpu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4065134..4066135
Genome map
AA seq 333 aa AA seqDB search
MRTISPVTFHPSDSGADMDNLFHQPQGGNEMPRFAGRATMMRLPFIENLQGLDAAFVGIP
LDIGTSQRSGTRYGPRYIRAESVMIRPYNMATGAAPFDSLSVADIGDVPINTYSLLKSVQ
IIEDYYTGLNSYPLIPLTLGGDHTITLPILRALTKKHGPVGLIHVDAHTDTNDEMFGEKI
AHGTTFRRAVEEGLLDLKRVVQIGQRAQGYAAGDFQWGVDQGFRLVQAEQCWHTSLAPLM
AEVRQQMGDGPVYLSFDIDSLDPIWAPGTGTPEVGGLTSIQALEIVRGCRGLNLIGADLV
EVSPPYDVSGNTSQLAANLLYEMLCVLPGVKYA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcactatctctcctgttacgtttcatccgtcagattcaggagcagacatggataac
ctctttcaccaaccgcagggtggcaatgagatgccacgcttcgccggacgcgccacaatg
atgcgcctgccgtttatcgaaaatttacagggacttgacgcggcatttgtcggcattccg
ctggatatcggcacctcgcagcgctcgggcacgcgctacggaccacgctatattcgcgcc
gaatcggtgatgatccgtccgtacaatatggcgaccggcgccgcgccgttcgactcgctg
tcggtggctgatatcggcgatgtgccgatcaatacctacagcctgctcaaatcggtgcaa
attatcgaagattactacaccggtttgaatagttatccgctgatcccgctgaccctcggc
ggggaccacaccattaccctgccgatcctgcgggcgctgaccaaaaaacatggtccggtg
ggcctcatccacgtcgacgcccataccgacaccaatgatgagatgttcggagagaaaatc
gcccacggcaccaccttccgccgcgccgttgaggagggactgctcgacctcaaacgggtg
gtgcagattggccagcgcgcccagggctatgccgccggcgacttccagtggggcgttgac
cagggctttcgcctggtgcaggcggagcagtgctggcatacctcgctggcgccgctgatg
gccgaagtccgccagcagatgggcgacgggccggtgtatctcagctttgatatcgatagc
ctcgatcccatctgggctccaggaaccgggacgccggaagttggcggtctgacctccatt
caggcgctggagatcgtccgcggctgccgcggcctgaatctgattggcgccgatctggtc
gaggtctcgcccccctacgacgtgagcggtaatacctcccagctggcggccaacctgctg
tacgagatgctctgcgtcctgcccggcgtgaagtacgcctga

DBGET integrated database retrieval system