KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_4232Help
Entry
KP1_4232          CDS       T00910                                 

Definition
putative arginase/agmatinase/formiminoglutamase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KP1_4232
Enzymes [BR:kpu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     KP1_4232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4065134..4066135
Genome map
AA seq 333 aa AA seqDB search
MRTISPVTFHPSDSGADMDNLFHQPQGGNEMPRFAGRATMMRLPFIENLQGLDAAFVGIP
LDIGTSQRSGTRYGPRYIRAESVMIRPYNMATGAAPFDSLSVADIGDVPINTYSLLKSVQ
IIEDYYTGLNSYPLIPLTLGGDHTITLPILRALTKKHGPVGLIHVDAHTDTNDEMFGEKI
AHGTTFRRAVEEGLLDLKRVVQIGQRAQGYAAGDFQWGVDQGFRLVQAEQCWHTSLAPLM
AEVRQQMGDGPVYLSFDIDSLDPIWAPGTGTPEVGGLTSIQALEIVRGCRGLNLIGADLV
EVSPPYDVSGNTSQLAANLLYEMLCVLPGVKYA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcactatctctcctgttacgtttcatccgtcagattcaggagcagacatggataac
ctctttcaccaaccgcagggtggcaatgagatgccacgcttcgccggacgcgccacaatg
atgcgcctgccgtttatcgaaaatttacagggacttgacgcggcatttgtcggcattccg
ctggatatcggcacctcgcagcgctcgggcacgcgctacggaccacgctatattcgcgcc
gaatcggtgatgatccgtccgtacaatatggcgaccggcgccgcgccgttcgactcgctg
tcggtggctgatatcggcgatgtgccgatcaatacctacagcctgctcaaatcggtgcaa
attatcgaagattactacaccggtttgaatagttatccgctgatcccgctgaccctcggc
ggggaccacaccattaccctgccgatcctgcgggcgctgaccaaaaaacatggtccggtg
ggcctcatccacgtcgacgcccataccgacaccaatgatgagatgttcggagagaaaatc
gcccacggcaccaccttccgccgcgccgttgaggagggactgctcgacctcaaacgggtg
gtgcagattggccagcgcgcccagggctatgccgccggcgacttccagtggggcgttgac
cagggctttcgcctggtgcaggcggagcagtgctggcatacctcgctggcgccgctgatg
gccgaagtccgccagcagatgggcgacgggccggtgtatctcagctttgatatcgatagc
ctcgatcccatctgggctccaggaaccgggacgccggaagttggcggtctgacctccatt
caggcgctggagatcgtccgcggctgccgcggcctgaatctgattggcgccgatctggtc
gaggtctcgcccccctacgacgtgagcggtaatacctcccagctggcggccaacctgctg
tacgagatgctctgcgtcctgcccggcgtgaagtacgcctga

DBGET integrated database retrieval system