KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_4337Help
Entry
KP1_4337          CDS       T00910                                 

Definition
(RefSeq) phospho-beta-glucosidase B
  KO
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KP1_4337
Enzymes [BR:kpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     KP1_4337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4160593..4161993)
Genome map
AA seq 466 aa AA seqDB search
MQQYQFPQGFLWGAAASGPQTEGVTNKRHRSIWDSWFAEQPERFYQQVGPQTVCDTYHQY
PQDVALMKQTGFNSFRTSIQWSRLIADLETGAPDPDAVRFYHAYLDEMIANGIEPMINLY
HFDMPEALQKQYGGFESAHVAELFARFARTAFSLFGHKVKYWITFNEPIVPVEGGYLYDF
HYPCKKDGRLAAQVAFNIMLAHAKAVTAYRELALAGEIGVVLNLTPSYTLTDSDADKKAA
GYADLFFNRSFLDPLVKHEFPKALCEILAAHDCLPTTSKDDAALILSADIDFLGVNYYVP
RRVKARESEYDLDYFTPEYYFENAVNPQGRFNPYRDNNEILPQAIYDIAANIRDNYGNIK
WYLAEIGIAMDRQSEGEPGADGVIDDTFRIQLMEEHLVQLHRAIADGANCFGVHQWTFID
NWSWINAFKRRYGFWRLDLETGERQIKRNALWFAELASSNGFTSDK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagtatcagtttccgcaagggttcctgtggggggcggcggcgtccggcccgcaa
acggaaggggtcaccaataagcgccatcgttccatctgggacagttggtttgccgaacag
ccggagcgattttatcagcaggtagggccgcagaccgtgtgtgatacttatcatcagtat
ccgcaggacgtagcgctgatgaaacagaccggcttcaactcatttcgtacctcgatacag
tggtcacgactgatcgctgatttggaaaccggcgcgccggacccggacgcggtgcgtttt
tatcacgcctatctggatgagatgatcgccaacggcattgagccgatgatcaatctctac
cactttgatatgccggaagcgctgcagaaacagtacggcggctttgaatcggcgcacgta
gccgagctgtttgcccgctttgcccgcaccgcctttagcctgtttggccataaggttaaa
tactggataaccttcaacgagccgattgtgccggttgagggaggctacctgtacgacttc
cactatccatgtaagaaagatggccggctggcggcgcaggtggcgtttaacattatgctg
gcgcacgccaaagcggtaacggcttatcgtgaactggcgctggcgggcgagatcggcgtg
gtgctcaacctgaccccgagctataccctcaccgacagcgacgcggataaaaaagccgcc
gggtatgccgacctgttttttaaccgcagcttccttgacccgctggtaaaacatgaattc
cccaaagcgctgtgcgagatccttgccgcccacgactgcctgccgacgaccagcaaagac
gacgcggcgttgatcctcagcgcggatatcgattttcttggggtaaactattacgtgccg
cggcgggtaaaagcgcgtgagagcgaatatgacctcgattatttcaccccggaatactat
ttcgaaaacgcggtgaacccgcagggccgctttaatccttatcgtgataacaacgagatc
ctgccgcaggcgatctatgacattgccgccaatattcgcgataactacggcaatattaag
tggtatctcgcggaaatcggcatcgcgatggatcgacaatcagagggcgagcccggggcg
gacggggtgatagacgatactttccgcatccagctgatggaggagcatctggtgcagctg
catcgggcgatagccgacggcgcgaactgctttggcgtgcaccagtggacgtttatcgac
aactggtcgtggatcaatgccttcaaacggcgctacggcttctggcgactggatctggag
accggcgagcgacagataaaacgcaatgcgctgtggtttgccgaactggcgtccagcaac
ggttttaccagcgataaatag

DBGET integrated database retrieval system