KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_4609Help
Entry
KP1_4609          CDS       T00910                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Brite
Enzymes [BR:kpu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KP1_4609 (dsbC)
Secretion system [BR:kpu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   KP1_4609 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4413690..4414403)
Genome map
AA seq 237 aa AA seqDB search
MKKGLLMFTLLAASLSGAAHADSAAIKQSLAKLGVQSTDIQPSPVSGMSTVLTDSGVLYV
TDDGKHIIQGPMYDVSGAQPVNVTNQLLLGKLNALSNEMIVYKAPKEQHVITVFTDITCG
YCHKLHEQMSDYNALGITVRYLAFPRQGLQSQAEQDMKAIWCAKDRNKALDDAMNGKGVQ
PASCSVDIAKHYTLGVQMGVNGTPAMVLSNGMVLPGYQGPKELKAFLDEHKKQTSGN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttattgatgttcaccctgctggcggcctccctttcaggagcggcgcac
gccgatagcgcggcaattaaacagtcgctggcgaagctgggtgtgcagagcaccgatatt
caaccatcgccggtttccgggatgagcacggtgctgaccgacagcggcgtgctgtacgtg
accgacgacggcaaacatatcatccaggggccgatgtacgacgtgagcggcgcgcagccg
gtcaacgtcaccaaccagctgctgctgggtaagctgaacgcgctgagcaatgagatgatt
gtctacaaagcgccgaaggagcagcacgtcatcaccgtcttcaccgatattacctgcggc
tactgtcataaactgcacgagcagatgagcgactacaacgcgctggggatcaccgtgcgc
tatctggctttcccgcgccagggtctgcaaagccaggcggagcaggacatgaaggccatc
tggtgcgcgaaagatcgcaacaaagcgctggatgacgccatgaatggtaaaggcgtgcag
ccggcgagctgcagcgtagatatcgccaaacattacaccctcggcgtgcagatgggcgtc
aacggtacgccggcgatggtcctcagtaacggcatggtgctgccgggctatcaggggccg
aaagagctgaaggcgttccttgatgagcacaaaaaacagacaagcggtaactga

DBGET integrated database retrieval system