KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_4619Help
Entry
KP1_4619          CDS       T00910                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase A
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kpu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4419967..4421400
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWDQGGKGPSICDVLTGGAHGVPREITHQVEAGKYYP
NHEAVDFYGRYKEDIKLFAEMGFKCFRTSIAWTRIFPQGDETQPNEEGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQQYGGWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHDNPEETMYQVLHHQFVASALAVKAARRINPDMQVGCML
AMVALYPYSCKPEDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIRMEDGDAQ
ILREGTCAYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPHVKASDWGWQIDPVGLRYSL
CELYERYQKPLFIVENGFGAYDKVEADGSINDDYRIDYLRAHIEEMIKAVTYDGVDLLGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGENL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaacccttccgaaagattttttatggggcggcgcggtcgccgcgcatcag
gttgaaggcggctgggatcagggcggcaaaggccccagcatctgcgatgtgttgaccggc
ggggcgcacggcgtgccgcgcgaaatcacccaccaggtcgaagcgggaaaatactacccg
aaccacgaagccgtcgacttctacggtcgctacaaagaagacatcaaactgttcgccgag
atgggcttcaaatgcttccgcacctctatcgcctggacccgcatcttcccgcagggtgac
gaaacccagccgaatgaagaggggctgaagttctacgacgacatgttcgacgagctgctg
aaatacaacatcgaaccggtgatcaccctctcccacttcgagatgcccctgcacctggtg
cagcagtacggcggctggaccaaccgcaaagtggtcgatttctttgtacgcttcgccgaa
gtggtcttcgagcgctataagcacaaagtgaaatactggatgacctttaacgagatcaac
aaccagcgcaactggcgcgcgccgctgttcggctactgctgctccggggtggtctatacc
gagcatgacaatccggaagagaccatgtaccaggtgctgcaccaccagttcgtggccagc
gcgctggcggtgaaagcggcgcggcgcatcaacccggacatgcaggtcggctgcatgctg
gcgatggtcgccctctacccttactcctgcaaaccggaagatgtcatgttcgcccaggag
tcgatgcgcgagcgctacgtctttaccgacgtccagctgcgcggttactacccgagctat
gtgttgaatgaatgggaacgccgcggcttcaacatcaggatggaagacggcgacgcgcag
atcctgcgcgaaggtacctgcgcctatctcggcttcagctactacatgaccaacgcggtg
aaagctgagggcggcactggcgacgccatttccggtttcgaaggcagcgtgccgaacccg
cacgtcaaagcttccgactggggctggcagattgacccggtcggcctgcgctattctctg
tgtgaactgtatgagcgttatcagaagccgctgttcatcgtggaaaacggctttggcgcc
tacgacaaagtagaagctgacggcagcatcaacgatgactaccgcatcgactacctgcgc
gcccacatcgaagagatgatcaaagcggtcacttatgacggcgtcgatctgctgggctat
accccatggggctgcatcgactgcgtctccttcaccaccgggcagtacagcaaacgctac
ggcttcatctacgtcaacaaacacgacgatggcaccggcgacatgtcccgctcgcgcaag
aagagctttaactggtacaaagaggtcatcgccagcaacggtgagaacctgtaa

DBGET integrated database retrieval system