KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_4648Help
Entry
KP1_4648          CDS       T00910                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KP1_4648 (speB)
Enzymes [BR:kpu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     KP1_4648 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4450042..4450962)
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPMNFMPYESDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPNEGLIDPNH
SVQIGIRTEFDKDNGFTVLDAGQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttaggtcatcaatacgataactccctggtatccaatgcctttggctttctg
cgtttgccgatgaactttatgccgtatgaaagcgatgcggactgggtcatcaccggcgtg
ccgttcgatatggcgacctccgggcgcgcgggcggccgtcatggcccggcggcgatccgt
caggtttccactaaccttgcctgggagcacaaccgtttcccgtggaacttcgatatgcgc
gagcgcctgaacgtggtggactgcggggatctggtgtacgccttcggcgacgcgcgcgaa
atgagcgagaagctgcaggctcacgccgagaagctgctggcggccggcaaacgtatgctc
tcctttggcggcgaccacttcgttaccctgccgctgctgcgcgcccatgccaagcacttt
ggtaaaatggcgttggtgcacttcgatgctcacaccgatacctacgccaacggctgcgag
ttcgaccacggcaccatgttctataccgcgccgaacgaagggcttatcgatccgaaccac
tccgtacagatcgggatccgcaccgaattcgacaaagacaatggctttacggtgctcgac
gccggccaggttaacgaccgcagcgttgatgacgtgattgcccaggtgaagcagatcgtc
ggcgacatgccggtgtacctgacctttgatatcgactgtctggatccggcgtttgcgcca
ggcaccggtaccccggttatcggtgggctgacctccgaccgcgcgatcaagctggtgcgc
ggcctgaaggacctgaacatcgtcgggatggacgtggtggaagtcgccccggcctacgat
cagtccgaaattaccgctctggcggcggcgaccctggcgctggagatgctgtacatccag
gcggcgaaaaagggcgaataa

DBGET integrated database retrieval system