KEGG   Klebsiella pneumoniae NTUH-K2044: KP1_4848Help
Entry
KP1_4848          CDS       T00910                                 

Gene name
pfkB
Definition
6-phosphofructokinase II
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
kpu  Klebsiella pneumoniae NTUH-K2044
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KP1_4848 (pfkB)
   01230 Biosynthesis of amino acids
    KP1_4848 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KP1_4848 (pfkB)
   00030 Pentose phosphate pathway
    KP1_4848 (pfkB)
   00051 Fructose and mannose metabolism
    KP1_4848 (pfkB)
   00052 Galactose metabolism
    KP1_4848 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    KP1_4848 (pfkB)
Enzymes [BR:kpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KP1_4848 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4622620..4623534
Genome map
AA seq 304 aa AA seqDB search
MIHTLTLNTAIDMNIFCDPLQPAAVNRTRQTEYCPNGKGVNVSLVLHHYQQPTHVMGIFG
GFTGRYIVEELRKQHINVTPAWVAEPTRINIFINDGSDEYKLVNPGARIDDEGKEQILHH
LQCVAPGDYLVISGSLPPGIESRFYSEILVLCQQKGCEVILDISHPVLRQLLEWRPLLIK
PNDDELKEIFGLDVSSPRRVREAMQTLHQLGARNVLLTLGAQGLYFSNGAQLWFCSAPKI
ELVSSACAGDAALGAFLSHWLNTDDIPQALALASATGADVAASAGLGKLNRTQELLQQLQ
IVQL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgatccacaccctgacactgaataccgcgatcgatatgaatatcttttgcgatccgctc
cagccggcggcagtcaaccgcacccggcaaacggaatattgcccgaatggtaaaggggtt
aacgtctcgctggtattacatcattaccagcagccaacccatgtcatgggcatattcggc
ggttttaccggccgctatatcgttgaggaactacgcaaacagcatattaatgtcacaccg
gcatgggtcgctgaaccgacccgtataaatatatttattaacgacggcagtgatgaatac
aaactggtaaatcccggcgcgcggattgacgatgaaggaaaagaacaaattcttcaccat
ttacagtgcgtcgcgcccggtgattatttagttatcagcggcagtctgccaccgggaata
gagagccggttctatagcgagattctggtgctgtgccagcagaaagggtgtgaagtcatc
ttagatatcagccacccggtgctgcgccagctgttagagtggcgtccactattgattaaa
cccaatgacgacgagctgaaagagatctttggtctggatgtcagcagcccccggcgggta
cgcgaagcaatgcaaacgctccaccagctcggggctcgcaatgttctgctgacccttggc
gcgcaagggctctatttttcgaacggcgcgcaactgtggttctgctcggcaccgaaaatc
gaactggtcagctcggcctgcgccggcgatgccgcgctgggtgcattcctcagccattgg
cttaacacagacgatattccccaggccctggcgctggccagcgccaccggcgctgatgtg
gccgcctccgccgggctgggtaaattaaaccgtacgcaagaattattacaacaacttcag
atcgtccaattataa

DBGET integrated database retrieval system