KEGG   Klebsiella pneumoniae PMK1: PMK1_00743Help
Entry
PMK1_00743        CDS       T03419                                 

Gene name
sacA
Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpx  Klebsiella pneumoniae PMK1
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PMK1_00743 (sacA)
   00500 Starch and sucrose metabolism
    PMK1_00743 (sacA)
Enzymes [BR:kpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PMK1_00743 (sacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(815360..816796)
Genome map
AA seq 478 aa AA seqDB search
MMTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYS
TQWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHG
DPGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDCWYMIVGAREG
DTGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAGFS
NRNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFSTPDGRRIVIGWLDMWESP
LPEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVDNC
EAMEVNLRWDCARSSAEQYGLRFGDGLRIYVDAQQQRLVLERHYPQYGLCGTRSVPLTAG
ADLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGSAALTEAGAWQLE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttacacaatctcccgggctgaacaggtactccagacacaacgccaggcgctg
aatctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaacgaccca
aacggtctggtgtggttcgacggctggtaccatgccttttatcaacatcacccgtactcc
acccagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcactgggag
catttgccggtagccctggcgccggagggcccggaggataaagacggctgcttctccggc
tcggcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttccacggc
gatcctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgcgacggg
atccactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccacttccgt
gacccgaaggtctggcgtgaaggagactgctggtacatgatcgtcggcgcgcgcgaaggc
gataccggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggacgcgggg
gtgctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttcttcacc
ctcaacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcggggttcagc
aaccgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccagcgtttt
attcgccatggcgaattccgggagatggataacggccacgatttctatgccccgcaaagc
ttctccacccccgatggccggcggatcgtgattggctggctggatatgtgggaatcgccg
ctgccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctgagcctg
agtgcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgcggcgcc
tggttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgacaactgc
gaggcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcagtatggt
ctgcgctttggcgatggcctgcgcatctacgtggatgcccaacagcagcgtctggtgctg
gagcggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgaccgccgga
gcggatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtcaatgac
ggcgaagcctgcctgagcagccgtatctatccgcaggctccccgccgtgaattagcgtta
tttgcctggagcggctcggcggcattaaccgaagccggcgcctggcagctcgaataa

DBGET integrated database retrieval system