KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH27: KPNIH27_06170Help
Entry
KPNIH27_06170     CDS       T03370                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpz  Klebsiella pneumoniae subsp. pneumoniae KPNIH27
Pathway
kpz00052  Galactose metabolism
kpz00500  Starch and sucrose metabolism
kpz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH27_06170
   00500 Starch and sucrose metabolism
    KPNIH27_06170
Enzymes [BR:kpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KPNIH27_06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIA40920
Position
complement(1303714..1305114)
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPQALADSHYPQWHLAPVNGLLNDPNGFCQVAGRYHLFYQWNP
LACDHTYKCWGHWSSADLLHWRHEPIALMPDEEYDRNGCYSGSAVEFEGALTLCYTGNVK
FPDGGRTAWQCLATENADGTFRKLGPVLPLPEGYTGHVRDPKVWRQDGRWYMVLGAQDVQ
QRGKVLLFTASDLREWRLVGEIAGHDVNGLANAGYMWECPDLFPLADTHLLICCPQGLAR
EAQRFLNTYPAVWMAGRFDAEHGIFDHGPLHELDSGFEFYAPQTMQADDGRRLLVGWMGV
PDGDEMHQPTRAQGWIHQMTCVRELEWQAGTLYQRPLRELVALRGEAQGWRGQTLPLAPM
ELAFDLSPDSTLGLDFAGALQLTVNRDGLRLSRRGLQTAEMHHRYWRGEARRLRIFIDRS
SVEIFINDGEGVMSSRFFPGYPGQLIFSGATPVAFCRWLLQPCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgtcacgcctgcctgcgatcctgcaggccgttatgcagggccagccgcag
gcgctggccgacagccattatccgcaatggcatctggcgccggtcaacggactgctgaac
gatcctaacggcttttgccaggtcgccgggcgttaccacctgttttatcagtggaacccg
ctcgcctgcgaccatacctataagtgctggggacactggagctctgccgatctgctgcac
tggcggcacgaacctatcgccctgatgccggatgaagagtatgaccgcaacggctgctac
tctggcagcgcggtcgagttcgagggcgccctgactctgtgctacaccggcaacgtgaaa
ttccccgacggcgggcgcaccgcctggcaatgtctggcgaccgagaatgctgatggcacc
ttccgcaagctggggccggtgctgccgctgccagaaggctataccggccatgtgcgcgac
cctaaagtgtggcggcaggacgggcgctggtacatggttcttggggcgcaggatgtgcaa
cagcgcggcaaagtgctgctgtttaccgccagcgacctgcgggagtggcgcctggtgggc
gagatcgccgggcacgacgtgaacggcctggcgaacgccggctacatgtgggagtgcccg
gatctctttccgctggcggacacccacctgctgatctgctgcccgcaggggctggcccgc
gaagcgcagcgctttctcaatacctatccggcggtgtggatggcaggccgcttcgacgcc
gaacacgggatcttcgaccacggcccgctgcacgagctggacagcggatttgagttctac
gcgccgcagaccatgcaggccgatgatggccgccgcctgctggtcggctggatgggcgtc
cccgacggggacgagatgcatcagcccacccgcgcgcagggctggatccatcagatgacc
tgcgtgcgtgagctggagtggcaggctggcactctgtatcaacgtccgctgcgcgagctg
gtcgccctgcgcggggaagcccagggctggcgcggacagaccctgcccctcgccccgatg
gagctggcctttgacctttcccccgacagcacgctggggctggactttgccggcgccctg
cagctcaccgtcaatcgcgacggtctgcgtctgtcgcgccgcggcctgcagacggcggag
atgcatcaccgctactggcgcggcgaggcgcgacgcctgcggatctttatcgaccgctcc
agcgtggagattttcatcaacgatggcgaaggggtgatgagcagccgcttcttcccgggc
tatccggggcagctcatcttcagcggtgcgacgccggtggcattctgccgctggctgctg
cagccatgcatggtagaataa

DBGET integrated database retrieval system