KEGG   Klebsiella quasivariicola: B8P98_04725Help
Entry
B8P98_04725       CDS       T05116                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kqv  Klebsiella quasivariicola
Pathway
kqv00052  Galactose metabolism
kqv00500  Starch and sucrose metabolism
kqv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kqv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    B8P98_04725
   00500 Starch and sucrose metabolism
    B8P98_04725
Enzymes [BR:kqv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     B8P98_04725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ASV22849
UniProt: A0A223UIQ5
Position
929012..930445
Genome map
AA seq 477 aa AA seqDB search
MTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDSWYMIVGAREGD
TGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAEGFRN
RNLFQSGYLIGEWQPGQRFIRHGDFREMDHGHDFYAPQSFATPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELSLSADNRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVDNCE
AMEVNLRWDCAHSSAEQYGLRFGDGLRLYVDAQQQRLVLERHYPQYGLCGTRSVPLTAGA
DLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPCRELALFAWSGSAALTEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacaatctccagggctgaacaggtcctccagacacaacgccaggcgctcaat
ctgcgctggtatccacactatcacctggcggcccgcgccgggtggatcaacgaccctaac
ggtctggtgtggttcgacggctggtaccatgccttttatcaacatcacccgtactccacc
cagtgggggccgatgcactgggggcatgcgcgcagtaaggatctggtgcactgggagcac
ctgccggtagccctggcgccggaggggccggaagataaagacggctgcttctccggttcg
gcagtggtggatggcgataccctggcgctgatttacaccgggcataagttccacggcgat
cctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgcgacgggatc
cattttgagcgccaggggatggtggtcgacaccccgccgggcatgcaccacttccgtgac
ccgaaggtctggcgggaaggggatagctggtacatgatcgtcggcgcgcgcgaaggcgat
accggccaggtgcggctgtaccgttcagcggatctgcgccagtggcaggatgcgggcgtg
ctggatgaagcggaaagcaccatgggctacatgtgggagtgcccggacttcttcactctc
aacggtaagcgcgtcctgatgttttctccgcaggggatgcaggccgaagggttccgcaac
cgcaatctgttccagagcggctatctgatcggtgagtggcagccggggcagcgttttatt
cgccacggcgacttccgggagatggaccatggccacgatttctatgctccgcaaagcttc
gccacccccgatggccgacggatcgtgattggctggctggatatgtgggaatcgccgctg
ccggagcagcaggacggctgggcgggcatgctctccctgccgcgggagctgagcctcagc
gcggataaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgcggcgcctgg
ttcccgtggccggtcagcaccctgaacaaccagcagaccacgatggtcgacaactgcgag
gcgatggaggtgaatctgcgctgggactgcgcccacagcagcgccgagcagtatggtctg
cgctttggcgatggcctgcgcctctacgtggatgcccaacagcagcgtctggtgctggag
cggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgaccgccggggcg
gatctcaacctgcggatatttttcgatagctcttcggtggaggtcttcgtcaatgatggc
gaagcctgcctgagcagccgtatctatccgcaggccccttgccgtgaattagcgttattt
gcctggagcggctcggcggcattaaccgaagccggcgcctggcagctcgaataa

DBGET integrated database retrieval system