KEGG   Kineococcus radiotolerans: Krad_0112Help
Entry
Krad_0112         CDS       T00562                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00010  Glycolysis / Gluconeogenesis
kra00052  Galactose metabolism
kra00500  Starch and sucrose metabolism
kra00520  Amino sugar and nucleotide sugar metabolism
kra00521  Streptomycin biosynthesis
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01130  Biosynthesis of antibiotics
kra01200  Carbon metabolism
Module
kra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kra_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krad_0112
   00052 Galactose metabolism
    Krad_0112
   00500 Starch and sucrose metabolism
    Krad_0112
   00520 Amino sugar and nucleotide sugar metabolism
    Krad_0112
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Krad_0112
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Krad_0112
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Krad_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABS01603
JGI: Krad0112
UniProt: A6W464
Position
complement(2206577..2207518)
Genome map
AA seq 313 aa AA seqDB search
MSAADAVLAVDVGGSSLKGAVFTTDGRTLAPATRPTGTGTAAVDAIAGFLRELADRAQAQ
GLHVAGAGVVTPGTVDERTGVVGYASNLGWRDVPLRDLLTAASGLPVATGHDVRAAGLAE
RLFGAARGVADFVLVPLGTGVAAAVRTSGHTVTGATGAAGEFGHVPVVPDGELCPCGQRG
CLEVYASGGGVARRYAARTGTALRAEEVVARLGRDGAADAVWADAVAALSSGLVTLTMLL
DPRLVVLGGGFTAAGDALLVPLRERLSRQLVWRAAPEVRVAQLGSGAGRVGAAVLALRRC
GIAPPAALVPAPG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggcggacgcggtcctcgccgtcgacgtcggcggctcctccctcaagggggcg
gtcttcaccaccgacgggcgcaccctcgcccccgcgacccggcccaccgggacgggcacc
gcggccgtcgacgcgatcgccggcttcctgcgcgagctcgccgaccgggcgcaggcgcag
ggtctgcacgtcgccggggcgggggtcgtgacccccgggacggtcgacgagcgcaccggc
gtcgtcggctacgcctcgaacctgggctggcgcgacgtgccgctgcgcgacctgctcacc
gccgcctccggcctgccggtcgccaccggccacgacgtgcgcgcggcgggtctggccgag
cggctcttcggcgccgcgcgcggggtcgccgacttcgtcctcgtccccctgggcaccggg
gtcgccgccgccgtgcgcacctccgggcacaccgtcacgggggccaccggggccgccggg
gagttcggccacgtccccgtcgtccccgacggcgagctctgcccgtgcgggcagcggggg
tgcctggaggtgtacgcctccgggggcggggtcgcgcgccgctacgccgcgcgcaccggc
accgcgctgcgggccgaggaggtcgtggcccggctgggccgcgacggcgccgccgacgcg
gtgtgggccgacgccgtcgccgcgctcagcagcgggctggtgaccctgacgatgctgctg
gacccgcggctcgtcgtcctcggcggggggttcaccgcggccggggacgcgctgctcgtc
ccgctgcgcgagcggctgtcgcggcagctggtgtggcgcgcggcgccggaggtgcgggtc
gcgcagctcgggtcgggcgcgggacgggtcggggccgccgtgctggccctgcggcggtgc
gggatcgccccgcccgccgcgctcgtccccgcccccggctga

DBGET integrated database retrieval system