KEGG   Kineococcus radiotolerans: Krad_0180Help
Entry
Krad_0180         CDS       T00562                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
kra  Kineococcus radiotolerans
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Krad_0180
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Krad_0180
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Krad_0180
Enzymes [BR:kra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Krad_0180
Exosome [BR:kra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Krad_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2132185..2134200
Genome map
AA seq 671 aa AA seqDB search
MSDTQSTADENNSQERRGFFTRRGLLGTGGLATAVVFGKGLVDASAASAAPAYVPAQLNA
KDAHYSTTFRRITRSTGTGSAVKVLPLDRAKFQVGSTFDLRVEATGVDPETTRIVIRVSD
GSGPAPLLGPAPVRTSSAPDSVEVTYRDFVYPAAGTFTIAAAVSSSAGSASQEVTHEVVL
ADASGETAKNVIFFLGDGMGQAAITGARILSKGITEGKYDAFLEMDTLDFRGNVTTSGSD
SIATDSANSMSAYMTGHKTAVNAMGVYPGNSEDPTASPRVETMAEVLKRSRGMSIGIVTT
AEIQDATPAAVFAHTRRRSEYLDIMEQALTPEQMPDVYMGGGRASLLPQSQKGSRRTDER
NLIEEFKDKGFAYAGTRTELSAVMAAGTPDKLLGTFHNGNLNVYIDRRITPDPAVLGEFP
DQPGLVEMTRAALKVLEKNDKGFFLMVEGASIDKSEHPLDGPRAVYDTIELDQAVAVAKE
WAKDRDDTLIVVTADHNHAMSIAGTHTLSREGSPARQQNGVYADAGFPTYVDADGDGFPD
DPNPDVQLFFGWSNHPDHPDDFAHNPVLAQPALEDPATEQAFPNPNRDPGAVVQIGNLPL
EETNCVHTVEDVFIGASGPGAQRFAKLLDNTEVFHNVIAALGLQIPTYSLRSSGGKVAEA
EVAATEATPAG
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacacccagtcaaccgcagatgagaacaactcgcaagagcgccgtgggttcttc
acccgccggggcctgctggggacgggcggtctcgcgaccgccgtcgtcttcggcaagggc
ctcgtcgacgcctccgccgcctccgcggccccggcctacgtgcccgcccagctgaacgcc
aaggacgcgcactactccacgaccttccgccggatcacgcgcagcaccggcaccggcagc
gcggtcaaggtcctccccctggaccgcgcgaagttccaggtcggctcgacgttcgacctg
cgcgtcgaggccaccggggtcgaccccgagaccacgcggatcgtcatcagggtcagcgac
ggcagcggccccgccccgctgctgggccccgctcccgtccgcaccagctccgcccccgac
tcggtcgaggtcacctaccgggacttcgtctacccggccgccggcaccttcaccatcgcc
gccgcggtgtcctcctccgcgggttccgcctcccaggaggtgacgcacgaggtggtgctg
gccgacgcctcgggcgagaccgccaagaacgtcatcttcttcctcggcgacggcatgggc
caggccgccatcaccggcgcccggatcctctccaagggcatcaccgagggcaagtacgac
gccttcctggagatggacaccctcgacttccgcggcaacgtcaccacctccggcagcgac
tcgatcgccaccgactccgccaactcgatgtcggcgtacatgaccggccacaagacggcc
gtcaacgccatgggcgtctacccgggcaactccgaggacccgacggccagcccgcgcgtg
gagacgatggccgaggtgctcaagcgctcgcgcggcatgtccatcggcatcgtcaccacc
gccgagatccaggacgccaccccggccgcggtgttcgcgcacacccgccgccgctccgag
tacctcgacatcatggagcaggcgctgacgccggagcagatgcccgacgtctacatgggc
ggcggccgcgcctcgctcctcccccagtcccagaagggttcgcgccgcacggacgagcgc
aacctcatcgaggagttcaaggacaagggcttcgcctacgcgggcacccgcaccgagctc
tccgccgtcatggcggccgggacccccgacaagctgctcgggacgttccacaacgggaac
ctgaacgtctacatcgaccgccggatcaccccggaccccgccgtcctcggcgagttcccc
gaccagcccggcctcgtggagatgacgagggccgcgctgaaggtcctggagaagaacgac
aagggcttcttcctcatggtcgagggcgcctcgatcgacaagtccgagcacccgctcgac
ggcccccgcgccgtgtacgacacgatcgagctcgaccaggccgtggccgtggccaaggag
tgggcgaaggaccgcgacgacaccctcatcgtcgtgaccgccgaccacaaccacgcgatg
agcatcgccggcacgcacaccctctcccgggagggttcgcccgcccgccagcagaacggc
gtgtacgccgacgccgggttccccacctacgtcgacgcggacggcgacgggttccccgac
gaccccaaccccgacgtgcagctgttcttcggctggtcgaaccaccccgaccaccccgac
gacttcgcgcacaaccccgtcctggcccagccggcgctggaggaccccgccaccgagcag
gcgttccccaaccccaaccgcgacccgggcgcggtcgtccagatcggcaacctgccgctg
gaggagaccaactgcgtccacacggtcgaggacgtcttcatcggcgcctccggccccggc
gcgcagcgcttcgcgaagctgctggacaacaccgaggtgttccacaacgtcatcgcggcg
ctgggcctgcagatcccgacgtactcgctgaggagcagcggcggcaaggtcgccgaggcc
gaggtcgcggcgacggaggccacgccggccggctga

DBGET integrated database retrieval system