KEGG   Kineococcus radiotolerans: Krad_0550Help
Entry
Krad_0550         CDS       T00562                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
kra  Kineococcus radiotolerans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1735197..1736393
Genome map
AA seq 398 aa AA seqDB search
MRLHRTPPTTTARRLVGLALAPTMLALAAAAPSAAAPRADAQQAQAQAAQRHGGQDTLRR
AAPRDLAVGTAVAGGGHHAEQDYADPFAYDVEYRERMAAEFSSLSPENQAKWEYIHPRRD
FYNFYPMDAIVRFAEENRQVVRGHTLFWHSQNPEWLEQGDFTDEELRAILKEHIQTVVGR
YAGRVQQWDVANEIVRDDGSGLRVGPTSEGGNIWITRLGEGIIADAFRWAHEADPRAKLF
FNDYGVEGINAKSTYYYELVQDLKAQGVPVDGFAIQGHLSTQYGFPGDLQANLQRFDALG
LETAVTELDVRMVLPENGIPTSAQQAQQADYYRRTLQACLAVEECNSFTIWGFTDKYSWV
PVFFAAEGSATVMTDDYERKPAYYALQSTLRDARRGGR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgcaccgaactccccccaccaccaccgcccggcgcctcgtcgggctggccctc
gccccgacgatgctggccctcgcggcggccgcgccgtccgcggccgccccccgcgccgac
gcccagcaggcccaggcgcaggccgcgcagcgccacggcggccaggacaccctgcgccgc
gccgccccgcgcgacctcgccgtcggcaccgccgtcgccggcggcggccaccacgccgag
caggactacgccgaccccttcgcctacgacgtcgagtaccgcgagcggatggccgcggag
ttcagctccctgtccccggagaaccaggcgaagtgggagtacatccacccccgccgcgac
ttctacaacttctacccgatggacgcgatcgtccggttcgccgaggagaaccgccaggtc
gtgcgcgggcacaccctgttctggcacagccagaacccggagtggctggagcagggcgac
ttcaccgacgaggagctgcgcgccatcctcaaggagcacatccagaccgtcgtcggccgc
tacgccgggcgcgtgcagcagtgggacgtcgccaacgagatcgtccgcgacgacggcagc
ggtctgcgcgtcggcccgaccagcgagggcggcaacatctggatcacccggctgggcgag
gggatcatcgccgacgcgttccgctgggcccacgaggccgacccgcgggcgaagctgttc
ttcaacgactacggcgtcgaggggatcaacgccaagagcacctactactacgagctcgtc
caggacctcaaggcccagggcgtgcccgtcgacgggttcgccatccagggccacctcagc
acccagtacgggttccccggcgacctgcaggcgaacctgcagcgcttcgacgccctgggc
ctggagaccgccgtcaccgagctcgacgtgcggatggtgctgccggagaacgggatcccg
accagcgcccagcaggcccagcaggcggactactaccgccggaccctgcaggcctgcctc
gcggtggaggagtgcaactccttcaccatctgggggttcacggacaagtactcctgggtc
ccggtcttcttcgccgccgagggctccgcgacggtcatgaccgacgactacgagcgcaag
cccgcgtactacgcgctgcagtccaccctgcgcgacgcgcgccgcggcgggcgctga

DBGET integrated database retrieval system