KEGG   Kineococcus radiotolerans: Krad_0619Help
Entry
Krad_0619         CDS       T00562                                 

Definition
uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
kra  Kineococcus radiotolerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Krad_0619
Enzymes [BR:kra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Krad_0619
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Krad_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1660213..1662036)
Genome map
AA seq 607 aa AA seqDB search
MSTMTNSPLVAGAAQAPEATLEVTTGTPVAPQAPEVSVLTEVTVAEEGRDAVPEQAGAKR
SGRSGKSLRSPGSERTAKAGKTLGHVSFVGAGPGDPGLLTVRAVDLLAAADVVVLDQTSR
EDLPARYGRDGVEVLDAGFGDDGQPLTRAARAKLVVKAAKAGGHVVRLMDGDASTFTGLA
DEIAACRKAGVSFDVVPGVSVVNAVPAYAGVPMTTGSTSSVNVVHPAGRSLDWSRHADKD
ATVVVLGTGDDIAAAAAGLLGAGRAASTPVAVTSHGTTTTQSTTTTTLGELEPLAAALDG
SPTTAVVGDVVALREQGSWYETKPLFGWRVLVPRTKEQAGGVTAKLSDHGATAEVVPTIS
VEPPRTPQQMEKAVKGLVTGRYEWIGFTSVNAVRAVREKFTEYGLDARAFSGLKVAAVGG
VTADALREWGIEPDLVPEGEQSASGLLEAWPPYDDVLDPINRVFLPRADIATDTLVAGLQ
ENGWEVDDVTAYRTVRAAPPAAPVRDAIKTGAFDAVVFTSSSTVRNLVGIAGKPHPSTVV
ACIGPATAKTAEEHGLRVDVLAPEPSADALVDALAGFGQGLRAAAVEAGEPVLRPSQKKS
SARRRAR
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgatgacgaacagccccctggtcgccggggcggcgcaggcaccggaggcgacc
ctcgaggtcaccaccgggacccccgtcgccccccaggcgcccgaggtgagcgtcctcacc
gaggtgaccgtggccgaggaggggcgcgacgccgtcccggagcaggccggggccaagcgc
tccggccggtcgggcaagtccctgcgcagccccgggtcggagcggaccgcgaaggccggg
aagaccctcgggcacgtgtccttcgtcggggccggacccggcgacccgggtctgctgacc
gtgcgcgcggtcgacctgctcgccgccgcggacgtcgtcgtcctcgaccagaccagccgc
gaggacctccccgcccgctacggccgcgacggcgtggaggtgctcgacgccggcttcggc
gacgacgggcagcccctgacccgcgccgcgcgggccaagctcgtcgtgaaggcggccaag
gccggcggtcacgtcgtgcgcctcatggacggcgacgcctccaccttcaccggcctggcc
gacgagatcgccgcctgccgcaaggccggggtgtccttcgacgtcgtccccggggtctcg
gtcgtcaacgcggtgccggcctacgccggggtgccgatgaccaccggctccacctccagc
gtcaacgtcgtgcaccccgcgggccggtccctggactggtcgcgccacgccgacaaggac
gccaccgtcgtggtcctcggcaccggcgacgacatcgccgccgccgcggccgggctgctc
ggcgcgggccgggcggcctcgacgccggtcgcggtcacctcccacggcaccacgaccacc
cagtccacgacgacgacgacgctgggggagctcgaacccctcgccgccgccctcgacggg
tccccgacgacggccgtcgtcggcgacgtcgtcgcgctgcgcgagcagggcagctggtac
gagacgaagccgctgttcggctggcgcgtcctggtgccgcgcaccaaggagcaggccggc
ggggtcaccgcgaagctgtccgaccacggcgccaccgccgaggtcgtcccgaccatctcc
gtggagccgccgcgcacgccgcagcagatggagaaggcggtcaaggggctggtgaccggg
cgctacgagtggatcgggttcacctcggtcaacgccgtgcgggccgtgcgggagaagttc
accgagtacggcctcgacgcgcgtgcgttctccggcctcaaggtcgccgccgtcggcggg
gtcaccgcggacgcgctgcgcgagtgggggatcgaaccggacctcgtgcccgagggcgag
cagtcggcctcggggctgctggaggcgtggccgccctacgacgacgtgctcgacccgatc
aaccgggtgttcctgccgcgcgccgacatcgccaccgacaccctcgtcgcgggcctgcag
gagaacggctgggaggtcgacgacgtcacggcctaccggacggtgcgggcggccccgccg
gccgcgccggtgcgcgacgccatcaagaccggcgccttcgacgcggtggtgttcacctcc
agctccacggtgcgcaacctcgtcgggatcgcgggcaagccgcacccctccacggtcgtg
gcctgcatcgggcccgccacggcgaagaccgccgaggagcacggcctgcgggtcgacgtg
ctcgctcccgagcccagcgcggacgccctcgtcgacgccctcgccgggttcggccagggg
ctgcgggcggcggccgtcgaggccggcgaacccgtgctgcggcccagccagaagaagtcg
tccgcgcgccgccgggcgcgctga

DBGET integrated database retrieval system