KEGG   Kineococcus radiotolerans: Krad_0767Help
Entry
Krad_0767         CDS       T00562                                 

Definition
D-cysteine desulfhydrase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
kra  Kineococcus radiotolerans
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:kra00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1515598..1516566)
Genome map
AA seq 322 aa AA seqDB search
MAPRDDRTVLGTWPTPVEAAPRLAAAIGLGPGDLLVKRDDLVGLAGGGNEVRELERTLGA
ALAEGARTVVTSGAPQSNHARLTAAAGARLGLDVVLVLEGSPPAAPGGNLLLDALLGARI
VWAGDVSPGELAARVEAEAEDLRAGDGAGGVAVVPFGGSSVLGARGYVDAGAELLEQVPD
LDVVVVAVGSGGTMAGLVHALGAHRVLGVDTGAVDDPEQRVRGFAAGLAAQDGTPAPGAL
RLRRDEVGAGYGVLTARVRQALTLVARTEGIVLDPVYTGRAAAGLLTAVEQGEIRPGQRT
VLLHSGGLPGLFGHPDAASLTG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtggcaccgcgagacgaccgcaccgtcctgggcacctggccgacgccggtggaggccgcg
ccccgcctggccgcggcgatcggcctcggacccggcgacctgctggtcaagcgcgacgac
ctcgtcggcctggccggcgggggcaacgaggtccgcgagctggagcgcaccctcggcgcg
gccctggcggagggggcgcggacggtggtcaccagcggcgcgccgcagagcaaccacgcc
cgcctcaccgccgccgccggtgcgcgcctcggcctggacgtcgtgctcgtgctggagggg
tcgccccccgcggccccgggcgggaacctgctgctcgacgcgctgctgggcgcccggatc
gtctgggccggcgacgtcagccccggcgagctggcggcccgggtcgaggcggaggccgag
gacctgcgggccggcgacggcgcgggtggggtcgcggtcgtgcccttcggcggttccagc
gtgctcggggcccgcggctacgtcgacgcgggggccgagctgctggagcaggtccccgac
ctcgacgtggtcgtggtcgccgtcggttccggggggaccatggccgggctcgtgcacgcc
ctcggcgcgcaccgcgtcctcggggtcgacaccggcgcggtggacgaccccgagcagcgg
gtgcgcgggttcgccgccggtctggccgcgcaggacgggacccccgcgcccggggccctg
cggttgcgccgcgacgaggtcggcgccggctacggcgtgctcaccgcgcgggtgcggcag
gcgctgacgctggtcgcgcgcaccgaggggatcgtcctggaccccgtctacaccggccgc
gccgccgcggggctgctgaccgcggtggagcagggcgagatccgtcccgggcagcgcacg
gtcctgctgcacagcggcgggctgccggggttgttcggccaccccgacgccgcgagcctc
acgggctga

DBGET integrated database retrieval system