KEGG   Kineococcus radiotolerans: Krad_1021Help
Entry
Krad_1021         CDS       T00562                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kra  Kineococcus radiotolerans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:kra00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1249536..1251104
Genome map
AA seq 522 aa AA seqDB search
MTRVTEDAHETAPVRLPGDQRPEHRGYVVAIDQGTTSTRCILFDHAGRLVAVAQREHRQH
YPRPGWVEHDAAEIWRNVARLVPQAMAQVEATPADVVAIGIANQRETVVAWDRRTGDPVS
PAVVWQDTRTTELVEEFSAHGGADRFTDVCGLPLTTYFSGPRITWMLRQDAGLRRRAENG
DVLFGTMDSWLVWNLTGGPDGGRHVTDVTNASRTMLMDLETLDYSERMLAEFGIPRRALP
RIVPSSQVYGAATTVVPGALIGAALGDQQAALFGQTCFSPGEAKCTYGTGSFLLMNTGTE
ITRSTHGLLTTVAHRIGEEPPVYALEGSIAITGALVQWLRDNLGLISTAPEIETLARTVE
DNGGCYFVPAFSGLFAPHWRSEARGLVIGLTSFVTKGHIARAALEATAWQTREVVEAMDA
DSGLRLASLRVDGGMTSNNLLMQTVADVLDAPVVRPMVNETVSLGAAYAAGLAVGFWPDL
DALRRRWHRAGQWSPTMGAEERELGWAYWQQAVQRTFDWIRH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcgtgaccgaggacgcgcacgagaccgcaccggtgcgcctgcccggggaccag
cgccccgagcaccgcggctacgtcgtcgccatcgaccagggcaccacctccacccgctgc
atcctcttcgaccacgccgggcggctggtcgccgtcgcccagcgcgagcaccgccagcac
tacccccggcccggctgggtcgagcacgacgccgcggagatctggcgcaacgtcgcgcgg
ctggtcccccaggccatggcccaggtcgaggccacccccgccgacgtcgtcgcgatcggg
atcgccaaccagcgcgagacggtcgtggcctgggaccgccgcaccggggacccggtgagc
cccgccgtggtctggcaggacacccgcaccaccgagctcgtcgaggagttctccgcccac
ggcggggccgaccgcttcaccgacgtctgcgggctgccgctcaccacgtacttctccggg
ccccgcatcacctggatgctgcgccaggacgcggggctgcgccggcgggcggagaacggc
gacgtgctgttcgggacgatggactcctggctggtctggaacctcaccggcggccccgac
ggcgggcggcacgtcaccgacgtcaccaacgccagccggacgatgctgatggacctggag
accctggactactccgagcggatgctcgcggagttcgggatcccgcgccgggcgctgccc
cgcatcgtccccagctcccaggtgtacggcgccgcgaccaccgtcgtccccggggccctc
atcggggccgcgctgggcgaccagcaggccgcgctgttcgggcagacctgcttctccccc
ggggaggccaagtgcacctacggcaccggcagcttcctgctgatgaacaccggcaccgag
atcacccgctccacccacggcctgctcaccaccgtggcccaccgcatcggcgaggaaccc
ccggtctacgcgctggaggggtccatcgccatcaccggcgccctcgtgcagtggctgcgc
gacaacctggggctcatctccaccgcccccgagatcgagaccctcgcccgcaccgtggag
gacaacggcgggtgctacttcgtccccgcgttctccgggctgttcgccccgcactggcgc
tcggaggcccgcgggctggtcatcggcctcacctcgttcgtcaccaagggccacatcgcc
cgggccgcgctggaggccaccgcctggcagacccgcgaggtcgtcgaggccatggacgcc
gactccggcctgcggctggcgtcgctgcgcgtggacggggggatgacctccaacaacctg
ctgatgcagaccgtcgccgacgtcctcgacgcccccgtcgtgcgccccatggtcaacgag
acggtgtcgctgggcgcggcctacgccgcgggtctcgcggtgggtttctggcccgacctc
gacgcgctgcgccggcgctggcaccgggccgggcagtggtcgccgaccatgggggcggag
gagcgcgaactgggctgggcgtactggcagcaggccgtccagcgcaccttcgactggatc
cggcactga

DBGET integrated database retrieval system