KEGG   Kineococcus radiotolerans: Krad_1097Help
Entry
Krad_1097         CDS       T00562                                 

Definition
magnesium chelatase, ChlI subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
kra  Kineococcus radiotolerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:kra00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1163386..1164816
Genome map
AA seq 476 aa AA seqDB search
MSISDTPTLPLQAPSDLPRTLGALRASGHRHVGVKEELRTNLVARMRAGEDRFPGVVGYE
DTVAPELERALLAGHDVVLLGERGQGKTRLLRSLVGLLDEWTPVIEGSELNEHPYAPLTP
ASRRRVAAEGDDLPVAWLHRSLRYGEKLATPDTSVGDLIGDVDPVKVAEGRALGDPETIH
FGLVPRTNRGIFAVNELPDLAERIQVSLLNVLEERDIQVRGYQLRLPLDLLLVASANPED
YTNRGRIISPLKDRFGAEVRTHYPLEVSMEVDLVRQEADTVAEVPEHLLEVLARFTRAVR
ESPAVDPASGVSARFSIAAAETVAAAALRRHALTGERGDAVARVGDLHTVVSVLGGKVEF
EQGEEGREVEVLEHLLRTAIAETYRSLLGGAELSGFAELVTEGRTVETGDLVPAERLLEQ
VGTVPGLGQVLGRLGLGDEPTPGRAASGVEFVLESLHLTRRLDKLVLDDGRTVYGS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcagcgacacccccacgctccccctccaggccccctccgacctcccccggacc
ctcggcgcgctgcgggcctccgggcaccgccacgtcggggtcaaggaggagctgcgcacc
aacctcgtcgcccgcatgcgcgccggggaggaccgcttccccggcgtcgtcggctacgag
gacaccgtcgcccccgagctggaacgggccctgctcgccggccacgacgtcgtcctgctc
ggcgagcgcggtcagggcaagacccgcctgctgcggtccctggtgggcctgctcgacgag
tggacacccgtcatcgagggcagcgagctcaacgagcacccctacgcccccctcaccccg
gcctcccgccggcgcgtcgccgccgagggcgacgacctgcccgtcgcctggctgcaccgg
tccctgcgctacggcgagaagctcgccacccccgacacctcggtcggggacctcatcggc
gacgtggacccggtgaaggtcgccgagggccgtgcgctgggcgacccggagaccatccac
ttcggcctcgtcccgcgcaccaaccgcgggatcttcgcggtcaacgagctgcccgacctc
gccgagcgcatccaggtgtcgctgctcaacgtgctggaggagcgcgacatccaggtccgc
gggtaccagctgcggctgccgctggacctgctgctggtggccagcgccaacccggaggac
tacaccaaccgcgggcggatcatctccccgctgaaggaccgcttcggcgcggaggtgcgc
acgcactaccccctggaggtgtcgatggaggtcgacctcgtccggcaggaggccgacacc
gtcgcggaggtgcccgagcacctgctggaggtgctggcccgcttcacccgcgcggtgcgc
gagtcccccgcggtggacccggcctcgggggtctcggcccggttctccatcgccgcggcg
gagaccgtggccgcggccgcgctgcgccggcacgcgctgaccggggagcggggggacgcg
gtggcccgcgtcggcgacctgcacaccgtggtcagcgtgctcggcggcaaggtggagttc
gagcagggcgaggagggccgcgaggtcgaggtgctggagcacctgctgcgcaccgcgatc
gcggagacctaccgctccctgctgggaggtgcggagctgtcggggttcgccgagctcgtc
accgagggccgcaccgtggagaccggtgacctggtgcccgccgagcggctgctggagcag
gtcggcaccgtccccggtctggggcaggtcctgggccgcctcgggctgggggacgagccg
acgccgggccgagccgcctcgggcgtggagttcgtcctggagtccctgcacctgacccgc
cgcctggacaagctggtcctggacgacggccggacggtctacggcagctga

DBGET integrated database retrieval system